KEGG   Symbiobacterium thermophilum: STH2441Help
Entry
STH2441           CDS       T00196                                 

Definition
chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sth00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2628142..2629779)
Genome map
AA seq 545 aa AA seqDB search
MESVFGLVRHPGNDALFRAVEMSLVSTLAGRPLHIHAEGLRGTGKTTIMRRVRKALPRIR
RIRGCLYNCDPSAPHCPVHRGLSPEEVAALGEERVPMPFLEISHAAKIGTVVGSIDLSRL
VSATHPEAALLPGTIPQAHRGILFVDEINRLAETSPELADVLLDVMGTRPGRVQIEETGL
PPVELPVLVSVWAASNPDEEPGPLEEIRRQLSDRFDFAIYTDRPSDPEVVEQILAAAEAG
EARPPRIADTKAELWRTRLTLRTADLRQVTIPPGIRRQVAALYSQFDLESLRGVEAIQAG
IRLSACLDGRREVQPEDLLRVVPMALRHRVDPELLRRVTSYLAEGLAPAETPAPLAAASG
GPATAPGRTRFPGLSFGGVLAEPARPLPAGAEPGTGRPSPGAAAGTGPGPDGRAEGVTGA
APAQTAASAAGTGPAPDPGPAGGPPTGPDAGTRSGDLQAAGSRGPVDPGTGAARLASGAG
AQPGEGTHGRAGGSWLHRALARLRVRPSLPDPATLPPQAPPNPARPLSALAPEDWVRTEE
ELGHP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttttcggcctggtgcggcatcccggcaacgatgcgctcttccgggccgtc
gagatgtcgctggtctccaccctggccggaaggcccctgcacattcacgccgaggggctc
aggggcaccggcaagacgaccatcatgcggcgggtgcggaaggcgctgccccgcatccgg
cgcatccggggctgcctgtacaactgcgacccgtccgccccccactgccccgtccaccgg
ggcctgagcccggaggaggtggcggcgctgggggaggagcgggtgccgatgccgttcctg
gagatctcccacgccgccaagatcggcacggtggtgggctccatcgacctgagccggctg
gtgagcgccacccatcccgaggcggcgctgctgcccggcaccatcccccaggcgcaccgg
ggcatcctgttcgtggacgagatcaaccggctggccgagacctcgcccgagctggccgac
gtgctgctggacgtcatgggcacccggccggggcgagtccagatcgaggagacgggcctg
ccgccggtggagctgccggtgctggtctcggtgtgggcggcctccaacccggacgaggag
ccgggccccctggaggagatccgccggcagctcagcgaccggttcgacttcgccatctac
accgaccggccgtcggaccccgaggtggtggagcagatcctcgccgccgccgaggccggc
gaggcccggccgccgcgcatcgccgatacgaaggccgaactgtggcggacccggctgacc
ctgcgcaccgccgatctgcgccaggtgacgatcccgcccggcatccgccggcaggtggcc
gcgctgtacagccagttcgacctggagtcgttgcggggggtggaggccatccaggccggc
atccggctctccgcctgcctggacggccgcagggaggtccagccggaggacctgctgcgg
gtggttcccatggctctgcgccaccgggtggatccggagctgctgcggcgggtgaccagc
tacctggccgaggggctggcgcccgcggagacgccggcgcccttggcggcggcttccggc
ggtccggcgacggccccgggccgcacccgcttccccggcctctccttcggcggcgtgctg
gccgagccggcccgcccgctgccggccggggcggagccgggaaccggccggccgtcgccg
ggagcggccgcggggacggggcccggtcccgacgggcgcgccgagggggttacgggagcc
gctcccgctcagactgcggcatccgcggcaggcaccggcccggctccggaccccgggccc
gccggaggaccacccacgggcccggacgccggcacacgttccggagatctgcaggcggcc
ggctcgcgcgggccggtggatccggggaccggggccgcccgcctggcatccggcgccggc
gcgcagccgggagaagggacgcacggaagagcgggaggctcgtggctgcaccgggcgctg
gcgcggctgcgcgtgcggccctcgctgcctgatccggcgacgctgccgccgcaagcgccg
cccaaccccgccaggccgctgagcgcgctggcgcccgaggactgggtccgcaccgaagag
gagctgggccacccgtga

DBGET integrated database retrieval system