KEGG   Symbiobacterium thermophilum: STH2441Help
Entry
STH2441           CDS       T00196                                 

Definition
chelatase
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    STH2441
Enzymes [BR:sth01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     STH2441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2628142..2629779)
Genome map
AA seq 545 aa AA seqDB search
MESVFGLVRHPGNDALFRAVEMSLVSTLAGRPLHIHAEGLRGTGKTTIMRRVRKALPRIR
RIRGCLYNCDPSAPHCPVHRGLSPEEVAALGEERVPMPFLEISHAAKIGTVVGSIDLSRL
VSATHPEAALLPGTIPQAHRGILFVDEINRLAETSPELADVLLDVMGTRPGRVQIEETGL
PPVELPVLVSVWAASNPDEEPGPLEEIRRQLSDRFDFAIYTDRPSDPEVVEQILAAAEAG
EARPPRIADTKAELWRTRLTLRTADLRQVTIPPGIRRQVAALYSQFDLESLRGVEAIQAG
IRLSACLDGRREVQPEDLLRVVPMALRHRVDPELLRRVTSYLAEGLAPAETPAPLAAASG
GPATAPGRTRFPGLSFGGVLAEPARPLPAGAEPGTGRPSPGAAAGTGPGPDGRAEGVTGA
APAQTAASAAGTGPAPDPGPAGGPPTGPDAGTRSGDLQAAGSRGPVDPGTGAARLASGAG
AQPGEGTHGRAGGSWLHRALARLRVRPSLPDPATLPPQAPPNPARPLSALAPEDWVRTEE
ELGHP
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggaatccgttttcggcctggtgcggcatcccggcaacgatgcgctcttccgggccgtc
gagatgtcgctggtctccaccctggccggaaggcccctgcacattcacgccgaggggctc
aggggcaccggcaagacgaccatcatgcggcgggtgcggaaggcgctgccccgcatccgg
cgcatccggggctgcctgtacaactgcgacccgtccgccccccactgccccgtccaccgg
ggcctgagcccggaggaggtggcggcgctgggggaggagcgggtgccgatgccgttcctg
gagatctcccacgccgccaagatcggcacggtggtgggctccatcgacctgagccggctg
gtgagcgccacccatcccgaggcggcgctgctgcccggcaccatcccccaggcgcaccgg
ggcatcctgttcgtggacgagatcaaccggctggccgagacctcgcccgagctggccgac
gtgctgctggacgtcatgggcacccggccggggcgagtccagatcgaggagacgggcctg
ccgccggtggagctgccggtgctggtctcggtgtgggcggcctccaacccggacgaggag
ccgggccccctggaggagatccgccggcagctcagcgaccggttcgacttcgccatctac
accgaccggccgtcggaccccgaggtggtggagcagatcctcgccgccgccgaggccggc
gaggcccggccgccgcgcatcgccgatacgaaggccgaactgtggcggacccggctgacc
ctgcgcaccgccgatctgcgccaggtgacgatcccgcccggcatccgccggcaggtggcc
gcgctgtacagccagttcgacctggagtcgttgcggggggtggaggccatccaggccggc
atccggctctccgcctgcctggacggccgcagggaggtccagccggaggacctgctgcgg
gtggttcccatggctctgcgccaccgggtggatccggagctgctgcggcgggtgaccagc
tacctggccgaggggctggcgcccgcggagacgccggcgcccttggcggcggcttccggc
ggtccggcgacggccccgggccgcacccgcttccccggcctctccttcggcggcgtgctg
gccgagccggcccgcccgctgccggccggggcggagccgggaaccggccggccgtcgccg
ggagcggccgcggggacggggcccggtcccgacgggcgcgccgagggggttacgggagcc
gctcccgctcagactgcggcatccgcggcaggcaccggcccggctccggaccccgggccc
gccggaggaccacccacgggcccggacgccggcacacgttccggagatctgcaggcggcc
ggctcgcgcgggccggtggatccggggaccggggccgcccgcctggcatccggcgccggc
gcgcagccgggagaagggacgcacggaagagcgggaggctcgtggctgcaccgggcgctg
gcgcggctgcgcgtgcggccctcgctgcctgatccggcgacgctgccgccgcaagcgccg
cccaaccccgccaggccgctgagcgcgctggcgcccgaggactgggtccgcaccgaagag
gagctgggccacccgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system