KEGG   Symbiobacterium thermophilum: STH2493Help
Entry
STH2493           CDS       T00196                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH2493
   01230 Biosynthesis of amino acids
    STH2493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH2493
  Energy metabolism
   00680 Methane metabolism
    STH2493
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH2493
Enzymes [BR:sth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STH2493
Exosome [BR:sth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STH2493
  Exosomal proteins of melanoma cells
   STH2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2675875..2676087)
Genome map
AA seq 70 aa AA seqDB search
MRGMAVLEEALAAGCQPVALVSHGCLVTLMLRELDPAFGFGDWVRMTTPDVYRATRRDAA
WRVDRVGTDA
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggggatggccgtcctggaagaagccctggcggcagggtgccaacccgtcgccctg
gtctcgcacggatgcctggtgacgctcatgctgcgggagctggaccctgcgtttggtttc
ggcgactgggtccggatgaccacgcccgatgtctaccgggcgaccaggcgcgatgcggca
tggcgggtggatcgggtggggacggacgcgtag

DBGET integrated database retrieval system