KEGG   Symbiobacterium thermophilum: STH2493Help
Entry
STH2493           CDS       T00196                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH2493
   01230 Biosynthesis of amino acids
    STH2493
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH2493
  Energy metabolism
   00680 Methane metabolism
    STH2493
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH2493
Enzymes [BR:sth01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     STH2493
Exosome [BR:sth04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   STH2493
  Exosomal proteins of melanoma cells
   STH2493
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2675875..2676087)
Genome map
AA seq 70 aa AA seqDB search
MRGMAVLEEALAAGCQPVALVSHGCLVTLMLRELDPAFGFGDWVRMTTPDVYRATRRDAA
WRVDRVGTDA
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggggatggccgtcctggaagaagccctggcggcagggtgccaacccgtcgccctg
gtctcgcacggatgcctggtgacgctcatgctgcgggagctggaccctgcgtttggtttc
ggcgactgggtccggatgaccacgcccgatgtctaccgggcgaccaggcgcgatgcggca
tggcgggtggatcgggtggggacggacgcgtag

DBGET integrated database retrieval system