KEGG   Symbiobacterium thermophilum: STH2557Help
Entry
STH2557           CDS       T00196                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00260  Glycine, serine and threonine metabolism
sth00750  Vitamin B6 metabolism
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01230  Biosynthesis of amino acids
Module
sth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STH2557
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STH2557
Enzymes [BR:sth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STH2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C
Motif
Other DBs
NCBI-ProteinID: BAD41542
UniProt: Q67LA4
Position
complement(2742688..2743887)
Genome map
AA seq 399 aa AA seqDB search
MARWHGVIRQYQRFLPVSERTPVVTLLEGNTPLVPAPRLGAELGLDLYLKFEGLNPTGSF
KDRGMTLAMSKAVEAGAKAVICASTGNTSASAAAYAARAGLPCYVVIPDGAVAMGKLAQA
LMYGARTIQIEGNFDDGLRLVRRLTQEHPEIALVNSVNPYRLQGQKTAAFEVVDALGGYP
DFLAIPVGNAGNITAYWMGFQEYAAAGVGAVESCSSSGAPAGALLPRMLGFQAAGAAPLV
HGGEVEDPQTVGTAIRIGRPASRAGALAAARESGGAFWAVTDEEMLAAYRRLAATEGIFA
EPASCASVAGLIKLCRLGYFEGRTGSAGDVSGVGGFIDGVPAPVPTHRPFTGRGGRPKVV
AVLTGHGLKDPDTAIRVSPLPEKLPADYGRLERLILSGS
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctggcacggtgtcatccggcagtaccaacgttttctgcccgtgagcgagagg
accccggtggtgacgctgctggagggcaacaccccgctggtgccggcgccccggctgggg
gcggagctggggctcgatctctacctgaagttcgaggggctgaaccccaccggctccttc
aaggaccgggggatgaccctcgccatgtccaaggcggtcgaggcgggggcgaaggcggtg
atctgcgcctccaccggcaacaccagcgcctccgcggcggcctacgccgcccgggcgggg
ctgccctgctacgtcgtcatccccgacggcgcggtcgccatgggcaagctcgcccaggcg
ctgatgtacggcgcccgcacgattcagatcgagggcaacttcgacgacgggctccggctg
gtgcgccgcctgacccaggagcacccggagatcgcgctggtcaactcggtcaacccgtac
cggctccaggggcagaagaccgccgccttcgaggtggtggacgccctggggggctacccc
gatttcctggcgatcccggtgggcaacgccggcaacatcaccgcctactggatgggcttc
caggagtacgccgccgccggcgtgggcgccgtcgagtcctgtagctccagcggggcgcct
gcgggggccctcctgccccgcatgctgggcttccaggcggcaggggcggcgccgctggtg
cacggcggcgaggtggaggacccgcagacggtgggcacggccatcaggatcggccgccca
gccagccgcgccggggcgctggccgcggcccgggagtcgggcggggcgttctgggcggtg
acggacgaggagatgctggcggcctaccgccggctggcggcgaccgagggcatcttcgct
gagcccgcctcctgcgcctccgtggccgggctgatcaagctgtgccggctcgggtacttc
gaggggcgcaccggcagtgccggcgatgtgtccggggtcggcggtttcatcgacggcgtg
cccgccccggtgccgacccaccggcccttcactggccggggcggccggcccaaggtcgtc
gccgtactgaccggacacgggctcaaggaccccgacacggccatccgggtttcgccgctg
cctgagaagctgcccgccgactacggccggctggagcggctgatcctctccgggagctga

DBGET integrated database retrieval system