KEGG   Symbiobacterium thermophilum: STH2660Help
Entry
STH2660           CDS       T00196                                 

Definition
arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    STH2660
  Amino acid metabolism
   00330 Arginine and proline metabolism
    STH2660
Enzymes [BR:sth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     STH2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2852237..2853178
Genome map
AA seq 313 aa AA seqDB search
MTIHVLGFPTTLGLPRHAVRHAPEALRATGLLDFLGQLDSRVIDHGDMAVPPGLRSDPVP
VRIAKVVEAARRQQQHWQRVARPGDLLFTIGGDHSTSLGTIMALAALGYDFDVVWVDAHG
DFNTVETSPSGNPHGMVLALATGLLPDAMDGVIRPDRLRLWGIRDLDPGERRLLSEARVE
VVSPAEVRARRAELLAGLRPNVFVSFDIDSVDPAEAPGTMTPVPGGFTRDEAVSLVADIV
RGRNLLALDVVEFHPDRDEGDATGRLAHAVIRAALEAWRGQSPIRSGSPCASRSDADSRP
SACASPTRRLYSP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccatgtactcggtttccccaccacgctggggctgccgcgccacgccgtacgg
cacgccccggaggccctgcgggctacggggctgctggacttcctggggcagctcgacagc
cgggtgatcgaccacggcgacatggcggtgccgcccgggctgcggtcggatcccgtgccc
gtgcgcatcgccaaggtggtggaggccgcccgccggcagcagcagcactggcagcgtgtc
gctcgtcccggcgacctgctgttcaccatcgggggcgaccattccacgtcgctgggcacc
atcatggcgctcgcggccctggggtacgatttcgacgtcgtgtgggtcgacgcccacggc
gacttcaacaccgttgagacgtcgccgtccggcaatccccacgggatggtcctcgccctc
gcgaccggactccttcccgatgcgatggacggggtcatccgcccggaccggctccggctc
tggggcatccgggacctggaccccggcgaacggcgactcctctccgaggcgcgggtcgag
gtggtctccccggccgaggtgcgcgcccggcgtgcggaactgctcgccggcctgaggccc
aacgtcttcgtctcgtttgacatcgactccgtggacccggccgaggcccccggcaccatg
acgcccgttcccggcggctttacccgggacgaggcggtgtcgctggtggccgacatcgtc
cgcggacggaacctcctcgcgctggacgtggtggagttccaccccgaccgggacgagggt
gacgcgaccggccgactggcccacgcggtgatccgggcagccctggaggcgtggcgcggt
cagtcgcccatccgctccggcagtccctgcgcctccaggtcggacgccgacagcaggcct
tcggcctgcgccagccccaccaggcggttgtactccccctga

DBGET integrated database retrieval system