KEGG   Symbiobacterium thermophilum: STH2660Help
Entry
STH2660           CDS       T00196                                 

Definition
(GenBank) arginase-family protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00220  Arginine biosynthesis
sth00330  Arginine and proline metabolism
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01130  Biosynthesis of antibiotics
sth01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    STH2660
   00330 Arginine and proline metabolism
    STH2660
Enzymes [BR:sth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     STH2660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase RPAP1_N
Motif
Other DBs
NCBI-ProteinID: BAD41645
UniProt: Q67L01
Position
2852237..2853178
Genome map
AA seq 313 aa AA seqDB search
MTIHVLGFPTTLGLPRHAVRHAPEALRATGLLDFLGQLDSRVIDHGDMAVPPGLRSDPVP
VRIAKVVEAARRQQQHWQRVARPGDLLFTIGGDHSTSLGTIMALAALGYDFDVVWVDAHG
DFNTVETSPSGNPHGMVLALATGLLPDAMDGVIRPDRLRLWGIRDLDPGERRLLSEARVE
VVSPAEVRARRAELLAGLRPNVFVSFDIDSVDPAEAPGTMTPVPGGFTRDEAVSLVADIV
RGRNLLALDVVEFHPDRDEGDATGRLAHAVIRAALEAWRGQSPIRSGSPCASRSDADSRP
SACASPTRRLYSP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaccatccatgtactcggtttccccaccacgctggggctgccgcgccacgccgtacgg
cacgccccggaggccctgcgggctacggggctgctggacttcctggggcagctcgacagc
cgggtgatcgaccacggcgacatggcggtgccgcccgggctgcggtcggatcccgtgccc
gtgcgcatcgccaaggtggtggaggccgcccgccggcagcagcagcactggcagcgtgtc
gctcgtcccggcgacctgctgttcaccatcgggggcgaccattccacgtcgctgggcacc
atcatggcgctcgcggccctggggtacgatttcgacgtcgtgtgggtcgacgcccacggc
gacttcaacaccgttgagacgtcgccgtccggcaatccccacgggatggtcctcgccctc
gcgaccggactccttcccgatgcgatggacggggtcatccgcccggaccggctccggctc
tggggcatccgggacctggaccccggcgaacggcgactcctctccgaggcgcgggtcgag
gtggtctccccggccgaggtgcgcgcccggcgtgcggaactgctcgccggcctgaggccc
aacgtcttcgtctcgtttgacatcgactccgtggacccggccgaggcccccggcaccatg
acgcccgttcccggcggctttacccgggacgaggcggtgtcgctggtggccgacatcgtc
cgcggacggaacctcctcgcgctggacgtggtggagttccaccccgaccgggacgagggt
gacgcgaccggccgactggcccacgcggtgatccgggcagccctggaggcgtggcgcggt
cagtcgcccatccgctccggcagtccctgcgcctccaggtcggacgccgacagcaggcct
tcggcctgcgccagccccaccaggcggttgtactccccctga

DBGET integrated database retrieval system