KEGG   Symbiobacterium thermophilum: STH2886Help
Entry
STH2886           CDS       T00196                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
sth  Symbiobacterium thermophilum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sth01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sth00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3110756..3112567
Genome map
AA seq 603 aa AA seqDB search
MTLGGYANRIARINLTSLTVEYDQVPKELLRKYIGARGLGVKFVFDNGPKVDPLSPDNLM
AVMIGPCTGSAVPMSGRLAIVTKSPLTGTITDSHMGGFTAARLRWAGFDGLLIKGRAWRP
VYLVVENGTVRIEDASHLWGLGVRATVRALQEKYGRENTSVMAIGPAGERLVRFAGWLNE
HDRASGRGGTGAVGGSKNLKAIVIIGDRSGQPQPLPERKEAFQEAVRMGQKAIMAAALTA
PNKGGLSLYGTNVLMNILNEAGSLPTRNAKESHFEHGEAISGEAFREFNLASEPVCHACP
VHCKKEVEVKEGRWKAKTESMEYETAWALGALCGLGDREPLVYMLDQCNDYGLDTIEMGV
TLAMAMEASEKGLTPEVINWGDAEKMSELIRKTAYREGFGDILANGAYGAACLLGDPDIA
LSVKGQAIPAYDPRGVQGIGLGYATSNRGACHLRGYTIASEIAGIPFPTDRTVTEGKAEL
LKTFQDLFGFLDSMDVCKFASFAQGAEEFSAQVRALTGFDDITPEEAMRIGERVYNLERH
YNNLNGFTGKDDTLPKRFFTEPATHNSAGMLSQLPVMLEEYYRLRGWKDGVVPEEKLKEL
EII
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgacattaggtggctacgcgaaccgcatcgcacgcatcaacctgaccagcctcacggtc
gagtacgaccaggtcccgaaggagctgctccgcaagtacatcggcgcgcgcgggctgggc
gtgaagttcgtgttcgataacgggcccaaggtcgacccgctctcgccggacaacctgatg
gctgtgatgatcgggccctgcaccggttccgcggttcccatgtcgggccgcctggccatc
gtgaccaagtccccgctgacgggcaccatcaccgactcgcacatgggcggcttcaccgcg
gcccggctgcgctgggcgggcttcgacgggctgctgatcaagggccgggcgtggcggccg
gtctacctggtggtggaaaacggcacggtccggatcgaggacgcctcccacctctggggc
ctgggcgtccgggccacggtgcgggccctgcaggagaagtacggcagggagaacacctcc
gtcatggccatcggccccgcgggcgagcggctggtgcgcttcgccggctggctgaacgag
catgaccgggcctccggccggggcggcaccggtgccgtcggcggctccaagaacctgaag
gccatcgtgatcatcggcgaccgctccggccagccccagccgctgcccgagcggaaggag
gccttccaggaggccgtgcgcatgggccagaaggcgatcatggccgccgcgctcacggcg
cccaacaagggcggtctgtcgctgtacggcaccaacgtgttgatgaacatcctcaacgag
gccggctccctgcccactcgcaacgcgaaggagagccacttcgagcacggggaggccatc
agcggcgaggccttccgggagttcaacctcgcctccgagccggtctgccacgcctgcccg
gtgcactgcaagaaggaggtcgaggtcaaggagggccgctggaaggcgaagaccgagtcc
atggagtacgagaccgcctgggccctgggcgcgctgtgcgggctgggcgatcgcgagccg
ctcgtctacatgctcgatcagtgcaacgactacggcctcgacaccatcgagatgggcgtg
accctcgccatggccatggaggcttccgagaaggggctgacgccggaagtcatcaactgg
ggcgacgcggagaagatgtcggagctgatccgcaagaccgcctaccgcgagggcttcggc
gacatcctggccaacggcgcgtacggcgccgcctgcctgctgggcgaccccgacatcgcg
ctgtccgtcaagggccaggccattccggcctacgacccgcgcggcgtgcagggcatcggc
ctgggctacgcgacctccaaccggggcgcctgccacctgcggggttacaccatcgcctcg
gagatcgcgggcatcccgttccccaccgaccgcacggtcaccgagggcaaggccgagctg
ctgaagaccttccaggacctgttcggcttcctggattccatggacgtgtgcaagttcgcc
agcttcgcgcagggcgccgaggagttctcggcccaggtgcgggccctgacgggcttcgac
gacatcacgcccgaggaggccatgcgcatcggcgagcgggtctacaacctcgagcgccac
tacaacaacctgaacggtttcaccggcaaggacgacacgctgcccaagcggttcttcacc
gagcccgccacccacaactcggccggcatgctgtcccagctgcccgtgatgctggaggag
tactaccggctgcggggctggaaggatggcgtggtgccggaagagaagctgaaggaactg
gagatcatctag

DBGET integrated database retrieval system