KEGG   Symbiobacterium thermophilum: STH300Help
Entry
STH300            CDS       T00196                                 

Definition
(GenBank) putative beta-N-acetylglucosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00520  Amino sugar and nucleotide sugar metabolism
sth01100  Metabolic pathways
sth01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    STH300
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    STH300
Enzymes [BR:sth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     STH300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: BAD39285
UniProt: Q67SQ8
Position
335351..336922
Genome map
AA seq 523 aa AA seqDB search
MRGVTAMSLAERAGELFMIGFRGTDPGDVPEALIRTEGVGGVILFARNLVSADQARRLTA
RIQSCSPDLPLLIAVDQEGGIVLRLAVTPWPGAMSLGAAGSPDLTRRVGAGIARELRAMG
INMNLAPVLDVNVNPANPVIGVRSFGSDPARVAEHGAAYIRGHHDEGVLATAKHFPGHGD
TDVDSHLALARVPHGMDRLEAVELVPFRWAIAAGVDAIMTAHVVFPAVEPDPDRPATLSP
AVLTGLLREQLGFDGLVITDCMEMKAIADHAGTAEGAVQAIAAGADLVLISHTERLQREA
IAAVRAAIASGRIPAWRVEEALRRVRAARERVAQRWQTADLADVGAPAHQALAAEAAAAA
VTAVGDLGSLVPLRPERALLLAVDPAPVVEVEEREPAGSPVLQAAARLAPALRAVGVRRD
PDPDEVERLVAAAAGADPVVVATFLAPRFPGQVALVRALQAAGHRVVLVPQRGPYDLLAV
PGMAGAVVMYEERPLAAEAALRCLLGQAAAPGRLPVALPGHSD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaggggagtgacggccatgtctctggctgagcgcgcaggggaactcttcatgatcggt
ttccgcggcaccgaccccggcgacgtgcccgaggccctcatccgcacggagggcgtgggc
ggggtcatcctcttcgcacgcaacctggtctcggcggaccaggcccgccgcctcacggcg
cgcatccagtcctgcagtcccgatctcccgctcctcatcgccgtcgaccaggaggggggc
atcgttctccggctggccgtcaccccctggcccggcgccatgagcctgggtgccgccggc
tcaccggacctcacccgacgggtgggtgccggcatcgcccgggagctccgggcgatgggc
atcaacatgaacctggccccggtgctcgacgtgaacgtcaaccctgccaatccggtcatc
ggcgtgcgctccttcggatctgaccccgcccgggtggccgagcacggggccgcctacatc
cgcggccaccacgatgagggagtgctggccactgcgaagcacttcccgggccacggggac
accgacgtggactcgcaccttgccctggcccgggtgccccacggcatggaccggctggag
gcggtggaactggtgccgttccgctgggcgatcgcggcgggggtggacgccatcatgacg
gcccacgtcgtctttcccgcggtggaaccggaccccgaccggccggccaccctctcgccc
gcggtgctgacgggcctgctgcgggagcaactgggcttcgacgggctggtgatcaccgac
tgcatggagatgaaggccatcgccgaccacgcggggaccgcggagggggcggtgcaggcc
atcgccgccggcgccgacctggtgctgatctcccacactgagcgcctccagcgggaggcg
attgcggcggtgcgggccgccattgcgagtggccgcatccccgcatggcgggtggaggag
gcgctgcgccgggtgcgggccgcccgggagcgggtggcgcaacgctggcagacggccgac
ctggccgacgtcggcgccccggcgcatcaggcgctggctgccgaggccgccgcagccgcg
gtgaccgccgtgggcgatctcgggtccctggtgcccctccggccggagcgggccctgctc
ctcgccgtcgaccccgcccccgtggtggaggtggaggaaagggagccagccggctcgccg
gtgctgcaggcggcggcacggctcgccccggctctgcgggccgtgggtgtgcggcgggac
ccggaccccgacgaggtggagcggctggtggcggcggcagccggggccgacccggtggtg
gtggccacgttcctggcgccgcgcttccccggccaggtggccctggtgcgggccctgcag
gcggcgggccaccgcgtggtcctcgtgccgcagcgggggccgtatgatctgctggccgtg
cccgggatggcgggggccgtggtgatgtacgaggagcggcccctcgcggcggaggcggcg
ctgcgctgcctgctgggacaggcggcggcgccgggccgtctgcccgtggcgctgccgggg
cacagcgactga

DBGET integrated database retrieval system