KEGG   Symbiobacterium thermophilum: STH300Help
Entry
STH300            CDS       T00196                                 

Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sth  Symbiobacterium thermophilum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sth00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:sth00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
335351..336922
Genome map
AA seq 523 aa AA seqDB search
MRGVTAMSLAERAGELFMIGFRGTDPGDVPEALIRTEGVGGVILFARNLVSADQARRLTA
RIQSCSPDLPLLIAVDQEGGIVLRLAVTPWPGAMSLGAAGSPDLTRRVGAGIARELRAMG
INMNLAPVLDVNVNPANPVIGVRSFGSDPARVAEHGAAYIRGHHDEGVLATAKHFPGHGD
TDVDSHLALARVPHGMDRLEAVELVPFRWAIAAGVDAIMTAHVVFPAVEPDPDRPATLSP
AVLTGLLREQLGFDGLVITDCMEMKAIADHAGTAEGAVQAIAAGADLVLISHTERLQREA
IAAVRAAIASGRIPAWRVEEALRRVRAARERVAQRWQTADLADVGAPAHQALAAEAAAAA
VTAVGDLGSLVPLRPERALLLAVDPAPVVEVEEREPAGSPVLQAAARLAPALRAVGVRRD
PDPDEVERLVAAAAGADPVVVATFLAPRFPGQVALVRALQAAGHRVVLVPQRGPYDLLAV
PGMAGAVVMYEERPLAAEAALRCLLGQAAAPGRLPVALPGHSD
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaggggagtgacggccatgtctctggctgagcgcgcaggggaactcttcatgatcggt
ttccgcggcaccgaccccggcgacgtgcccgaggccctcatccgcacggagggcgtgggc
ggggtcatcctcttcgcacgcaacctggtctcggcggaccaggcccgccgcctcacggcg
cgcatccagtcctgcagtcccgatctcccgctcctcatcgccgtcgaccaggaggggggc
atcgttctccggctggccgtcaccccctggcccggcgccatgagcctgggtgccgccggc
tcaccggacctcacccgacgggtgggtgccggcatcgcccgggagctccgggcgatgggc
atcaacatgaacctggccccggtgctcgacgtgaacgtcaaccctgccaatccggtcatc
ggcgtgcgctccttcggatctgaccccgcccgggtggccgagcacggggccgcctacatc
cgcggccaccacgatgagggagtgctggccactgcgaagcacttcccgggccacggggac
accgacgtggactcgcaccttgccctggcccgggtgccccacggcatggaccggctggag
gcggtggaactggtgccgttccgctgggcgatcgcggcgggggtggacgccatcatgacg
gcccacgtcgtctttcccgcggtggaaccggaccccgaccggccggccaccctctcgccc
gcggtgctgacgggcctgctgcgggagcaactgggcttcgacgggctggtgatcaccgac
tgcatggagatgaaggccatcgccgaccacgcggggaccgcggagggggcggtgcaggcc
atcgccgccggcgccgacctggtgctgatctcccacactgagcgcctccagcgggaggcg
attgcggcggtgcgggccgccattgcgagtggccgcatccccgcatggcgggtggaggag
gcgctgcgccgggtgcgggccgcccgggagcgggtggcgcaacgctggcagacggccgac
ctggccgacgtcggcgccccggcgcatcaggcgctggctgccgaggccgccgcagccgcg
gtgaccgccgtgggcgatctcgggtccctggtgcccctccggccggagcgggccctgctc
ctcgccgtcgaccccgcccccgtggtggaggtggaggaaagggagccagccggctcgccg
gtgctgcaggcggcggcacggctcgccccggctctgcgggccgtgggtgtgcggcgggac
ccggaccccgacgaggtggagcggctggtggcggcggcagccggggccgacccggtggtg
gtggccacgttcctggcgccgcgcttccccggccaggtggccctggtgcgggccctgcag
gcggcgggccaccgcgtggtcctcgtgccgcagcgggggccgtatgatctgctggccgtg
cccgggatggcgggggccgtggtgatgtacgaggagcggcccctcgcggcggaggcggcg
ctgcgctgcctgctgggacaggcggcggcgccgggccgtctgcccgtggcgctgccgggg
cacagcgactga

DBGET integrated database retrieval system