KEGG   Symbiobacterium thermophilum: STH3038Help
Entry
STH3038           CDS       T00196                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sth  Symbiobacterium thermophilum
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    STH3038
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     STH3038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3253919..3254506)
Genome map
AA seq 195 aa AA seqDB search
MHRNLNYGWIDVITSGSMYAGKTTELIRRVRTFILAKRTAVVFQPRMAKRYTDDEVIVTH
DGLRFEAVHTDSPLEILWYAEIHKPDVIGIDEAQFYDVSLVDTVQELANRGHYVIAAGLS
QTSEGRPFGCMPQLLALADSITSVYGVCVVCGEPATKPFALTAKTEDVVVGGGEKYEARC
RKCWLEGRRARGEQC
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
ttgcaccgtaatctcaactacggatggatcgatgtcatcacctcgggcagcatgtacgcc
ggcaagacgaccgagctgatccgccgggtccgaacgttcatcctggcgaagcggaccgcc
gtcgtcttccagccgcgcatggccaaacggtataccgacgacgaggtgatcgtgacccat
gacgggctccggttcgaggcggtccacaccgacagcccgctggagatcctctggtatgct
gagatccacaagcccgacgtgatcggcatcgacgaggcgcagttctacgacgtgtcgctg
gtggacacggtgcaggagctggccaaccgcggccattacgtgatcgcagccggactgtcg
cagacgtcggagggcaggcccttcggctgcatgccccagctgctggccctggcggacagc
atcacgtccgtatacggggtgtgcgtcgtctgtggcgaaccggccaccaagccgttcgcg
cttaccgcgaagaccgaggacgtggtggtgggtggcggcgaaaagtacgaggcccgctgc
cgcaagtgctggctggaggggagaagggcccggggcgagcaatgttga

DBGET integrated database retrieval system