KEGG   Symbiobacterium thermophilum: STH3264Help
Entry
STH3264           CDS       T00196                                 

Definition
pyruvate ferredoxin oxidoreductase gamma-delta subunit
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH3264
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH3264
   00020 Citrate cycle (TCA cycle)
    STH3264
   00620 Pyruvate metabolism
    STH3264
   00640 Propanoate metabolism
    STH3264
   00650 Butanoate metabolism
    STH3264
  Energy metabolism
   00680 Methane metabolism
    STH3264
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    STH3264
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     STH3264
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3483909..3484940)
Genome map
AA seq 343 aa AA seqDB search
MAATPTQGTIRLPVKDEHGCFNIRLESIGGYGANIAGKMLAEAGVLYQGLNGSNFSSYGS
EKKGSPVKSFIRFAEPDTPIRVSSPIEEPHIVCIFHEALIRTQPVVDGLRPGGVVIVNTR
KRPEEIRQMLGVDDVTIGTFDATTIAVETGSRVNMAVLGAIARAAEFLDPEAIKALITDT
FSKKYPHTVPGNLRCFDRGYAEIEFQSFGPSAEEGSARTRRSAAAYGYLNMPIGGVIPNP
GNMAVKDLSASRQGFLPEFDREKCIDCAQCDMVCPDYCFVWEQGVDKRGRPAMVLKGINY
QYCKGCLKCVEACPVDALREMREQDGYADAHTVRHDHLLVVGR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgacccccacgcagggaaccatccggctccccgtcaaggatgagcacgggtgc
ttcaacatccgcctggagtccatcggcggctacggcgccaacatcgccggcaagatgctc
gccgaggcgggtgtgttgtaccagggcctgaacggctccaacttctcctcctatggctcc
gagaagaagggctcgccggtcaagtccttcatccgctttgcggagccggacacgccgatc
cgcgtcagctcccccatcgaggagccgcacatcgtctgcatcttccacgaggccctcatc
cgcacccagccggtggtggacggcctgcgcccgggcggcgtggtgatcgtcaacacccgg
aagcggccggaggaaatccggcagatgctgggcgtggacgacgtcaccatcggcaccttc
gacgccacgaccatcgccgtggagaccggttcccgggtcaacatggccgtgctcggggcc
atcgcccgcgcggcggagttcctcgaccccgaggcgatcaaggcgctgatcaccgacacg
ttctccaagaagtacccgcacaccgtcccggggaacctgcgctgcttcgaccgcggctac
gcggagatcgagttccagtccttcggcccgtcggccgaggaggggagcgcccgcacgcgg
cgctcggcggccgcctacggctatctgaacatgcccatcggcggcgtcatccccaacccg
ggcaacatggcggtgaaggacctgagcgcctcgcgccagggcttcctgccggagttcgac
cgggagaagtgcattgactgcgcccagtgtgacatggtctgccccgactactgcttcgtg
tgggagcagggggtcgacaagcggggccggccggccatggtgctgaagggcatcaactac
cagtactgcaagggctgcctgaagtgcgtggaggcctgcccggtggacgccctgcgggag
atgcgggagcaggacgggtacgccgacgcgcacacggtgcggcacgaccatctgctggtt
gtggggaggtga

DBGET integrated database retrieval system