KEGG   Symbiobacterium thermophilum: STH3283Help
Entry
STH3283           CDS       T00196                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
sth  Symbiobacterium thermophilum
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH3283
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STH3283
Enzymes [BR:sth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     STH3283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3507282..3509096)
Genome map
AA seq 604 aa AA seqDB search
MTLTGYANRVARIDLTTGRIDYEPIDPEAARKYIGGRGLGVKYVFDNGPEVDPLSPENLL
CFMNGPLTGSAINMSGRLAVCTKSPLTGGVTDSHMGGWSAARLRWSGFDGLLFRGAAPTP
VYAICENGTVRLADASDLWGKGIRETVRILQERHGGRNVSVMAIGPAGENLVRYASILNE
NDRAAGRGGTGAVMGAKKLKAVVAIGDIKDQWKPADDRRNTFEDARKAGLKAIMEGALTA
PRKGGLSLYGTNVLMNIINEVGALPAFNGKETFHPDAEAISGETIRAQYLVEEPTCHACP
VACKKLVEIKEGPYAGVRTESFEYETAWALGVNCGLTDAGAVAKLLDLCNDYGMDTIELG
NVLSTTMEATELGLVKDGIAWGDAARMIEVAGLIARAEGDLGKTLGLGAYGAAKAFGRPD
LANSVKGQAIPAYDPRGIKGIGLGYATSNRGACHLRGYTVASEIAGIPEQTDRLATEGKG
ALLKVFQDLHAFSDSLDLCKFSAFAMGAEEYAQAYSAVTGVPFTAEDVMRTGERIYNLER
YYNNLAGLGEGSDYLPKRFLTEPATGGSAGQVSELDVMLQEYYAARGWQNGVVPVEKLRE
LEII
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcacgggctacgcgaaccgcgtcgcgcgcatcgacctgacgacagggcgcatc
gactacgaaccgatcgacccggaggcggcgcgcaagtacatcggcggccggggactcggt
gtgaagtacgtgttcgacaacgggccggaggtcgatcccctgtcgccggagaacctgctc
tgcttcatgaacggtccgctcacgggcagcgccatcaatatgtccggccgtctggcggtc
tgcacgaagtcgccgctcaccggcggggtgaccgactcccacatgggcggctggtccgcg
gccagactccgctggtcagggtttgacgggctgctgttccgcggggccgcgccgacgccc
gtctacgcgatctgtgagaacgggaccgtacggctggcggatgcctcggacctctggggc
aagggcatccgggagacggtgcggatcctgcaggagcggcacggcggcaggaacgtctca
gtcatggccattggcccggccggcgagaatctggtgcgttacgcctcgatcctgaacgag
aacgaccgcgcggccggtcgtggcggcaccggcgccgtgatgggcgccaagaagctgaag
gcggtcgtggccatcggcgacatcaaggaccagtggaagcccgcggatgaccgccggaat
accttcgaggatgcccgcaaggccggcctgaaggcgatcatggagggggcgctgaccgcg
ccgcgcaagggcggcctgtcgctctacggcacgaacgtgctgatgaacatcatcaacgag
gtcggggccctgccggccttcaacggcaaggagaccttccacccggatgccgaggccatc
tcgggggagaccatccgggcgcagtacctggtggaggagcccacctgccacgcctgcccc
gtggcctgcaagaagctggtggaaatcaaggaaggcccctacgcgggggtccgcaccgag
tccttcgagtacgagacggcgtgggcgctgggcgtcaactgcggcctgaccgacgccggg
gcggtggcgaagctgctggatctgtgcaacgactacggcatggacacgattgagctgggc
aatgtgctttccaccaccatggaggccaccgagctgggactggtgaaggacggcatcgcc
tggggcgacgccgcacggatgattgaggtggcgggtctcatcgcgcgcgcggagggggat
ctgggcaagaccctgggtctgggcgcgtacggtgcggcgaaggccttcggccggccggat
ctggccaactcggtgaaggggcaggccattccggcttacgacccgcgcggcatcaagggg
atcgggctggggtacgcgacctccaaccggggcgcctgccacctgcgcggctacacggtg
gcgtcggagatcgcggggatccccgaacagaccgaccggctggccacggagggcaagggc
gcgctgttgaaggtcttccaggacctgcacgctttctccgactccctcgacctgtgcaag
ttctcggccttcgcaatgggcgcggaggagtacgcgcaggcctacagcgcggtcaccggc
gtgccgtttacggcggaggacgtcatgcgcaccggcgagcgcatctacaacctggagcgg
tattacaacaacctggccgggctgggggagggcagcgattaccttccgaagcgcttcctc
acggagcctgcgaccggcggcagcgccggccaggtgtcggagctggacgtgatgctccag
gagtactacgcggcgcgcggctggcagaacggcgtggtgccggtagaaaaactccgggaa
ctggagatcatctga

DBGET integrated database retrieval system