KEGG   Symbiobacterium thermophilum: STH589Help
Entry
STH589            CDS       T00196                                 

Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sth  Symbiobacterium thermophilum
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH589
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    STH589
   00630 Glyoxylate and dicarboxylate metabolism
    STH589
Enzymes [BR:sth01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     STH589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
637124..638728
Genome map
AA seq 534 aa AA seqDB search
MDFRMLTLEGVSIRGALGERYDEVLTPEALEFLVQLHRRFAARRRELLRLRAERQERLDQ
GEWPDFLPETRHIREAEWQVAPYPPDLADRRVEITGPVDRKMMINALNSGARVFMADFED
ANTPTWANIVEGQINLIDAVKGTITYTSPDGRVYRLKEKVATLFVRPRGWHLPERHIVID
GEPASGSLVDFGLYFFHNARRLIEKGSGPYFYLPKLESHLEARLWNDVFCFAQDYLGIPR
GTIKATVLIETILAAFEMDEILWELREHSVGLNAGRWDYIFSCIKKFRNRPEVRFPDRSA
VTMTVPFMRAYTELLVKTCHRRGTFAMGGMAAFIPSRKDPRINAVALEKVRQDKEREAGD
GFDGTWVAHPDLVPVATAVFDEVLGERPNQIDRQRYDVEVGARDLLNFAATPGAITEEGL
RLNINVGIQYIESWLRGVGAAAIHNLMEDAATAEISRSQVWQWVRHGATLQDGRRVTPEL
VRELIEEEMERIHRQVGSRAFTCGRFQAARKLFEQVALSEEFPEFLTLPGYDLI
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtggatttccggatgctcaccctggagggcgtttcgattcggggcgcactgggcgagcgt
tacgacgaggtgctcacccccgaagcgctggagttcctggttcagctgcaccgccggttt
gcagccaggcgcagggagctgctccggctgcgcgctgagcggcaggagcggctggaccag
ggcgagtggcccgacttcctcccggagacccggcacatccgggaggcggagtggcaggtg
gcgccctacccgcccgacctcgcggaccggcgggtggagatcaccgggcccgtggaccgc
aagatgatgatcaacgccctgaactccggcgcccgggtgttcatggccgacttcgaggac
gccaacacccccacgtgggccaacatcgtcgaggggcagatcaacctgatcgatgccgtg
aagggcaccatcacctataccagccccgacggccgggtctacaggctgaaggagaaggtg
gcgacgctcttcgtgcggcccaggggctggcacctgcccgaacggcacatcgtgatcgac
ggcgagccggcctcgggcagcctggtcgacttcgggctctacttcttccacaacgcccgg
cggctgatcgagaagggcagcgggccgtacttctacctgccgaagctggagagccacctg
gaggcccgtctctggaacgacgtgttctgcttcgcccaggactacctgggcatcccccgc
ggcaccatcaaggcgaccgtgctgatcgagacgatcctcgccgccttcgagatggacgag
atcctgtgggagctcagggagcactcggtggggctcaacgccggacgctgggactatatc
ttcagctgcatcaagaagttccggaaccggcccgaggtccgcttccccgaccgcagcgcc
gtgacgatgaccgtcccgttcatgcgggcctacaccgagctgttggtgaaaacctgccac
cggcggggcaccttcgccatgggcggcatggcggcgttcatccccagccggaaggacccg
cggatcaacgccgtcgccctggagaaggtgcggcaggacaaggagcgggaggccggcgac
ggattcgacggcacgtgggtggcccaccccgacctggtacccgtcgcgaccgccgtgttt
gacgaggtgctgggcgagaggccgaaccagatcgaccggcagcgttacgatgtggaagtt
ggtgctcgcgatctcctgaactttgctgcgacgccgggcgccattaccgaggaagggctg
cggctcaacatcaacgtggggatccagtatatcgagtcgtggctccggggtgtgggggcc
gcggcgatccacaacctgatggaggatgccgccaccgccgagatttcccgctcgcaggtg
tggcagtgggtgcgccacggggcgaccctgcaggacgggcggcgggtgaccccggaactg
gtccgggaactgatcgaggaggagatggagcgaatccaccgccaggtggggtcccgggcc
ttcacgtgcgggcgcttccaggccgcccggaagctgtttgagcaagtggccttgtccgag
gagtttccggagttcctgacgctgcccggatacgacctgatctag

DBGET integrated database retrieval system