KEGG   Symbiobacterium thermophilum: STH602Help
Entry
STH602            CDS       T00196                                 

Definition
glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH602
   00052 Galactose metabolism
    STH602
   00500 Starch and sucrose metabolism
    STH602
   00520 Amino sugar and nucleotide sugar metabolism
    STH602
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    STH602
   00524 Butirosin and neomycin biosynthesis
    STH602
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     STH602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652141..653067
Genome map
AA seq 308 aa AA seqDB search
MVYLGIDIGGTGIKAAIVDGQGIILHRAEVPTGAAEGADAVLQRVRRLGLTLVERAGQPV
EACGVGSPGRIDHLRGHVIFASGNLPGWTGTALGAELHQTFGVPVVVDNDVNAAAVGEAW
IGAARGSSDFLMLTLGTGVGGALTVHGRLWRGARWGAGEVGHMALYPGGDPCPCGGRGCA
ERYVSSKALTRRANEGLVAGHPFRGVRDVIRTAEQGDGERQRAARLAVEQWTADLALFLM
NLQMAFDPQMIVVGGGITRLGYWWDRLVQAAARECRERSMSIRIRRAKLGPMAGVVGAAR
LAMLRRAR
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggtctatctgggcatcgacatcggcggcacgggcatcaaggcggccatcgtggacggg
cagggcatcatccttcaccgtgccgaggtgcccaccggcgcggcggagggagcggacgcc
gtcctgcagcgcgtccggcggctggggctcaccctggtggaaagggcggggcagccggtg
gaggcgtgcggcgtcgggtcgccgggccgcatcgatcacctccgggggcacgtgatcttc
gccagcgggaacctgccgggctggaccggcacggccctgggcgcggagctccatcagacc
ttcggcgtccccgtcgtggtggacaacgacgtgaacgcggcggccgtgggcgaggcctgg
atcggcgccgcccggggctcgtccgacttcctcatgctgacgctgggcaccggagtgggc
ggcgccctcaccgtgcacggccggctctggcggggcgcccggtggggcgcgggcgaggtc
ggccacatggcgctctaccccggcggcgacccctgcccctgcggcggccggggctgcgcc
gaacggtacgtctcgtccaaggcgctcacccgccgggccaacgagggactggtcgcgggc
catccgttccgcggggtccgagacgtgatccggaccgcggaacagggcgacggcgagcgg
cagcgcgccgcccgtctggccgtggagcagtggaccgcggacctggcgctcttcctgatg
aacctgcagatggccttcgacccgcagatgatcgtggtgggcggcggcatcacccggctc
ggctactggtgggatcggctggtgcaggccgccgcccgggagtgccgggaacggtccatg
tcaatccgcatccggcgggccaagctcggcccgatggccggtgtggtgggcgcagcccgt
ctggccatgctgagacgcgcccgctga

DBGET integrated database retrieval system