KEGG   Symbiobacterium thermophilum: STH693Help
Entry
STH693            CDS       T00196                                 

Definition
(GenBank) methyl-accepting chemotaxis protein
Organism
sth  Symbiobacterium thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
762352..764196
Genome map
AA seq 614 aa AA seqDB search
MRWGLRTTLTVGAIAIVAVLVSTIFMVVRALNIQREQYDDLANDLRMAQIKATQLQSHAQ
GQARSLWAYAATGSVDYLDQFETYRQYADEASNWLAATVESEQGVKLLTALRDAETAVSK
AVESLNRLNLTDLRAQLPALMPLMDDYIDAANAIAEYVDGAAGYQEIATIEATNRQRLVV
IGLIVGYGVVSAIIALVVIRGVVGVLEQVRAAVVQVADGDLSDVELRYDGNDPVGQMCRS
LREMIPALRGLVAGVGDTSRAVTESAAELHATTEEMSRSATMVAEAISQIARGTGEQAAA
ADNIQSRMRQLREAIDQIAGGAEEQAKQAQRAVEDLAGMLEQLSQASAHVRNVNRLAADA
LATAQEGQSTVLRSAAGMAEIQASVAATAEQVAGLGELSQQIGAITEAITAIADQTNLLA
LNAAIEAARAGEHGRGFSVVADEVRKLAERAASSANEIAALISRIQASTTEAVESMNRVN
AQVEAGVEMARSAEQGLGRIVTMVRDTQEHAAEVVRVTEKLVEDSRGIQSAVSEMAAVAE
ENSAATEEMAASSDSVLEAVAVIASSAQETAAAAQEVSASTEELTAGAETIAQSTQRLAG
MSRELLSRVGRFRY
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctggggtcttcgcacaacactgaccgttggcgccatcgcgatcgtcgcggttctg
gtctccaccattttcatggtggtgcgtgccctcaacatccagcgggaacagtacgacgac
ctggcgaacgaccttcgcatggcccagatcaaggccacccagctgcagtcccacgcccag
ggccaggcccgcagcctctgggcctacgccgcaacgggcagcgtcgactacctggaccag
ttcgagacctatcggcagtacgccgatgaggcgtccaactggctggccgccaccgtggag
agcgagcagggcgtgaagctgctgacggccctgcgcgacgcggaaaccgccgtgtcgaag
gccgtcgagtcgctgaaccggctgaacctgacggatctcagggcccagctccccgcgttg
atgccgctcatggacgactacatcgacgcggccaacgccattgccgagtacgtggacggc
gccgccggataccaggagatcgccaccatcgaggcgacgaaccggcagcggctggtcgtc
atcggcctcatcgtcgggtacggcgtcgtctcggcgatcatcgccctggtcgtgatccgg
ggcgtcgtgggcgtcttagagcaggtgcgggcggccgtggtccaggtcgccgacggcgac
ctctcggacgtggaactgcggtatgacggcaacgacccggtgggccagatgtgccgctcg
ctcagggagatgatcccggccttgcgggggctggtcgccggcgtcggcgacacctcccgc
gccgtcaccgagtccgcggccgaactgcacgcgaccacggaggagatgtcccgttcggcc
accatggtggcggaggccatctcccagattgcccggggcaccggcgagcaggcggccgcc
gcggacaacatccagtcccgcatgcggcagctccgggaggcgatcgaccagatcgccggc
ggcgccgaggagcaggcaaagcaggcgcagcgggccgtggaggacctggcggggatgctg
gagcagctctcgcaggcgtccgcacacgtgcggaacgtgaaccgtctggccgccgacgcc
ctggccaccgcccaggagggccagtccaccgtgctgcgctcggccgcgggcatggccgag
atccaggccagcgtggccgccacggctgagcaggtggcggggctgggcgagctgtcgcag
cagatcggcgccatcacggaggcgatcaccgccatcgcggatcagaccaacctgctcgcc
ctcaacgcggcgatcgaggccgcccgggccggcgagcacgggcgcggcttctcggtggtc
gcggacgaggtgcggaagctggcggagcgggccgcctcctcggccaacgagatcgcggcg
cttatcagccggatccaggcgagcaccaccgaggccgtcgagagcatgaaccgggtcaac
gcgcaggtcgaggccggcgttgagatggcccgttccgccgaacaggggttgggccgcatc
gtcaccatggtcagggacacccaggagcacgcggccgaggtcgtgcgggtgaccgagaag
ctggtggaggacagcagggggatccagtcggccgtgtccgagatggcggcggtcgccgag
gagaactccgccgccacggaggagatggccgccagttcggattccgtcctggaggccgtg
gccgtcattgcctcctcggcgcaggagacggccgccgcggcccaggaggtgtccgcctcc
accgaggagctgaccgccggcgccgagaccatcgcgcagtccacccagcggctggcgggc
atgtcccgggagctactctcccgggtcggacggttccggtactag

DBGET integrated database retrieval system