KEGG   Symbiobacterium thermophilum: STH771Help
Entry
STH771            CDS       T00196                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sth  Symbiobacterium thermophilum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    STH771
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     STH771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
868773..869711
Genome map
AA seq 312 aa AA seqDB search
MDRPVVVVGSLNLDLVVNPERAPAAGETVFAPRLDQFPGGKGANQAVAAARLSAPVAMVG
RVGQDAFGDRLLESLRADGVATEGISRSATAGTGTAVITVEATGQNRIVVVSGANAEVTP
ELVEAHGPLIASASALLLQLEVPVEACVRAAELAAAAGVPVILDPAPAPAEPLPEPLRRN
TWLITPNETEAAALTGVPVAGRCGAEEAARVLWAQGFRQVLIKLGSEGAYLFRGGAGQWF
EPFRVPVVDTTAAGDAFAGGLAAALHRGMALEEAVRWGMAAGALAVTRPGAQPAMGNLDE
LMTLLRTGRLDA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
ttggataggccagtggtggtggtagggagcttgaacctggacctggtggtgaacccggag
cgggcgcccgcggccggcgagaccgtcttcgccccgcggctcgaccagttcccgggaggg
aagggggcgaaccaggcggtggccgccgcgcgcctcagcgccccggtggcgatggtcggc
cgggtagggcaggacgccttcggcgaccggctgctggagagcctgcgggccgacggcgtg
gcgacggagggaatttcccggtcggccacggccggcacgggcaccgccgtgatcacggtg
gaggccaccggacagaaccggatcgtggtcgtgtccggcgccaacgccgaagtgaccccc
gagttggtggaggcccacgggccgctcatcgcctcggcttccgcgctgctgctgcagctg
gaggtgcccgtggaggcctgcgtccgggcggccgagctggccgcagcggcaggggtgccg
gtcatcctcgaccccgccccggcgccggcggagccgctgcccgagccgctgaggcggaac
acgtggctgatcacccccaacgagaccgaggccgccgcactcaccggcgtgccggtggcc
ggccgctgcggggcggaggaggcggcccgggtgctctgggcccagggcttccggcaggtg
ctgatcaagctgggcagcgagggcgcctacctgttccggggcggcgccggccagtggttc
gagcccttccgggttccggtggtggacacgacggccgcgggcgacgccttcgccggcggg
ctggccgcggcgctccaccgggggatggcgctggaagaggcggtgcgctggggcatggcc
gccggcgccctggccgtcacccggcccggcgcgcagccggcgatgggaaacctggatgag
ctcatgaccttgctgcggacagggaggttggacgcatga

DBGET integrated database retrieval system