KEGG   Symbiobacterium thermophilum: STH837Help
Entry
STH837            CDS       T00196                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sth  Symbiobacterium thermophilum
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    STH837
   01230 Biosynthesis of amino acids
    STH837
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH837
   00030 Pentose phosphate pathway
    STH837
   00051 Fructose and mannose metabolism
    STH837
   00052 Galactose metabolism
    STH837
  Energy metabolism
   00680 Methane metabolism
    STH837
Enzymes [BR:sth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     STH837
Protein phosphatases and associated proteins [BR:sth01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     STH837
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943879..944850
Genome map
AA seq 323 aa AA seqDB search
MPKIRKIGVLTSGGDAPGMNAAVRAAVRRGISLGAEVVGVRRGYAGLIAGEFVDLGVSSV
GDIIHRGGTFLQTARSDHFLTPEGQAQALAKAREAGIEGLVVIGGDGSFRGALRLTELGL
PAVGVPATIDNDIYGTDLTIGFDTAVNTCLDAIRKIRDTATSHERTFVLEVMGRHSGWIA
LAAGLAGGAESILLPERPMPMEEVVTRLKRGVERGKRHTLIIVAEGVGSGFEVGRQIREM
TGYDTRVMVLGHIQRGGSPTALDAMLASRMGAKAAEVLLEEGRGGLFIGVENEQMVTRPL
EQVLGRRKEIPDELVDLAEILAI
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaagattcgcaagatcggcgttctgaccagcggaggcgacgcaccgggcatgaac
gccgcagtccgtgccgcggtccggcgcgggatctcgctgggcgcggaggtggtcggcgtc
cggcgcgggtacgctggtctcattgcaggagagttcgtggatctcggagtcagctccgtc
ggcgatattatccatcgcggcggcaccttcctgcagacggctcgcagcgaccacttcctc
acgccggaagggcaggcgcaggccctggccaaggcgcgggaggccggcatcgaggggctc
gtggtgatcggaggcgacgggtcgttccgcggcgcgctgcggctcacggagctggggctg
cccgccgtcggcgtgcctgccaccatcgacaacgacatctacgggaccgacctcacaatc
ggtttcgacaccgcagttaacacgtgtctcgacgcgattcgcaagatccgcgacacggcc
acctctcatgagcgcaccttcgtgttggaggtcatgggtcgccattccggctggatcgcg
ctggccgccggcctcgcgggcggcgccgagtcgatcctgctccccgagcgtccgatgccc
atggaggaggtcgtgacccgcctgaagcggggcgtggagcggggcaagcggcacaccctg
atcatcgtggcggaaggcgtcggctccggtttcgaggtcggtaggcagatccgggagatg
accgggtacgacacgcgggtgatggtgctgggccacatccagcggggcggctcgcccacc
gcgctggatgcgatgctggcctcccgcatgggcgccaaggcggccgaggtgctgctggaa
gagggccggggcgggctcttcatcggcgtggagaacgagcagatggtgacccggccgctg
gagcaggtgctgggccgccgcaaggagatccccgacgaacttgttgacctggcggagatt
ctggcgatctga

DBGET integrated database retrieval system