KEGG   Symbiobacterium thermophilum: STH881Help
Entry
STH881            CDS       T00196                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sth  Symbiobacterium thermophilum
Pathway
sth00010  Glycolysis / Gluconeogenesis
sth00620  Pyruvate metabolism
sth00640  Propanoate metabolism
sth00680  Methane metabolism
sth01100  Metabolic pathways
sth01110  Biosynthesis of secondary metabolites
sth01120  Microbial metabolism in diverse environments
sth01130  Biosynthesis of antibiotics
sth01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sth00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STH881
   00620 Pyruvate metabolism
    STH881
   00640 Propanoate metabolism
    STH881
  Energy metabolism
   00680 Methane metabolism
    STH881
Enzymes [BR:sth01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     STH881
Lipid biosynthesis proteins [BR:sth01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   STH881
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: BAD39866
UniProt: Q67R27
Position
992238..994202
Genome map
AA seq 654 aa AA seqDB search
MDSKQFAALLNEDRRFPPPAEFAARANVADESLYEQAARDREGFWAAQAERLHWFRRWDK
VLEWNPPFAQWFLGGKLNVAYNCLDRHLQTHTRTKAAIIWEGEPGDERVLTYLDLHREVC
RFANVLRQMGVGKGDRVTIYLPMIPEAAVAMLACTRIGAIHSVVFGGFSAESLRDRINDS
RSKVVVTADGGWRRGNIIRMKQIVNEAVVDCASVEKVIVVKRIGHESLVEHGWHPGRDHW
YHTLMRNAPVTCPVEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYLTQVAATTKYVFDLK
DEDVYWCSADIGWITGHSYVIYGPLANGATTLMYEGAPDYPDRGRIWEIIQKYRVNIFYT
APTLIRSFMRWGEGWPSKYDLSSLRLLGTVGEPINPEAWMWYHKHIGGERCPIVDTWWQT
ETGAIMATPLPGVVHTKPGSTTRPFPGIEMAVVNEEGQEVPPGAGGYLVVKSPWPSMLRT
VWGDPDRYVSTYFGRFGHQVYFTGDGAKRDEDGYYWIIGRVDDVINVSGHRIGTMEVESA
LVDHPLVAEAAVIGRSHAVKGQAITAFVTLKEGRRGTPDLVDELKQHVVTKIGALARPEE
IYFAADLPKTRSGKIMRRLLRDIAEGRALGDTTTLADPNVVAQLRQQYESQEAG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggattccaagcagtttgcggcacttctcaacgaggaccggcgtttcccgccgccggcc
gagttcgccgcccgggccaacgtggcggatgagagcctctacgagcaggccgcgcgggac
cgggagggcttctgggccgcccaggcggagcggctgcactggttccggcggtgggacaag
gtgctggagtggaacccgccgtttgcccagtggtttctggggggcaagctgaacgtcgct
tacaactgtctcgaccgccacctgcagacgcacacccggacgaaagcggccatcatctgg
gaaggcgagcccggcgacgagcgggtgctcacctacctggacctgcaccgggaggtctgc
cgcttcgccaacgtgctccggcagatgggcgtcggcaagggcgaccgggtgaccatctac
ctgcccatgatccccgaggccgccgtcgccatgctggcgtgcacgcggatcggggccatt
cactcggtcgttttcggcggcttctccgcggagtcgctgcgcgaccgcatcaacgacagc
cgctccaaggtggtggtcaccgcggacggcggctggcggcgcggaaacatcatccgcatg
aagcagatcgtcaacgaggccgtggtcgactgcgcctccgtggagaaggtgatcgtggtc
aagcgcatcggccacgagtcgctggtggagcacggctggcaccccgggcgcgaccactgg
taccacacgctgatgcgcaacgcgccggtcacctgcccggtggaggagatggatgcggag
gatcccctgttcatcctgtacacctccgggtccaccgggaagccgaagggcgtgctgcac
accaccggcggctacctgacccaggtcgcggcgaccacgaagtacgtgttcgacctgaag
gacgaggacgtctactggtgctccgccgacatcggctggatcaccggccactcgtacgtg
atctacggcccgctggccaacggggccacgacgctgatgtacgagggcgcgcccgactat
ccggaccgcggccgcatctgggagatcatccagaagtaccgggtgaacatcttctacacc
gcgcccaccctgatccgttccttcatgcgctggggcgagggctggccgtccaagtacgac
ctctcttcgctgcggctgctgggtaccgtcggcgagcccatcaacccggaggcctggatg
tggtaccacaagcacatcggcggcgagcgttgcccgatcgtcgacacctggtggcagacg
gagaccggcgcgatcatggcgacgccgctgcccggcgtggtgcacacgaagcctgggtcc
accacgcggcccttcccgggcatcgagatggcggtggtgaacgaggagggccaggaggtg
cccccgggcgccggcggctacctggtggtcaagtcgccctggccgtccatgctgcgcacg
gtctggggcgatcccgaccggtacgtctccacctacttcggccggttcggccaccaggtc
tacttcaccggcgacggcgccaagcgggatgaggacggctactactggatcatcggccgg
gtcgacgacgtgatcaacgtctccggccaccgcatcggcaccatggaggtggagtcggcg
ctggtggaccatccgctggtggccgaggccgccgtcatcggccggtcccatgcggtgaag
ggccaggccatcaccgccttcgtcacgttgaaggaaggccggcggggcacgcccgacctg
gtggacgaactgaagcagcacgtggtcaccaagatcggcgccctggcccggccggaggag
atctacttcgcggccgacctgcccaagacccgttcggggaagatcatgcgccggctgctc
cgggacatcgccgagggccgggccctgggcgacaccaccactctggccgatcccaacgtg
gtggcgcagctgcgccagcagtacgagtcgcaggaagccggataa

DBGET integrated database retrieval system