KEGG   Sphaerobacter thermophilus: Sthe_0623Help
Entry
Sthe_0623         CDS       T01128                                 

Definition
helicase, RecD/TraA family (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sti  Sphaerobacter thermophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sti00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sthe_0623
Enzymes [BR:sti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sthe_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(692096..694309)
Genome map
AA seq 737 aa AA seqDB search
MAITSSSPSPPTAELEGTVERITYQNPSNGYTVLKVTTRRGAEVTVVGQLGGVNPGETLH
LDGFWTTHPQHGRQFQATGFRSILPATTEGIRKYLGSGLIRGVGPVTARRIVEHFGAEAL
DVIDQQPERLSEVRGLGPKRIKAIIAAWAEQRAIKDVMVLLQSLGVHTGLAVRIYREYGD
DALHIVQTDPYRLARDVWGIGFKTADTIGRSLGIPHDDPGRLAAGVRYVLSQAADRDGHV
YLPRDELVTAAAELLGCDPAQVDAVIPDLVAARDVFVEANDGVEAVYLSALGGAEIAVAR
RLSRLAAADDDRLAAFQSVDWERAFDWLHHTQGMPPLAAQQVAAVRTALTQRVTVLTGGP
GTGKSTTLRAVVTLARAKRASVILAAPTGRAAKRMAEVTGREAQTIHRLLKLQPGGAAFF
NEENPLPADLVVVDEASMLDVALCNTLLKAIEPGTHLLLVGDVDQLPSVGPGNILRDVID
SGAVPVVRLDEVFRQAEQSAIVRNAHRINHGEMPQWGRDIRDFAVLRLPEGPDVIERAAE
TIIELVQERLPRAYGLNPGEIQVLSPMNRGPAGTRRLNELLQEALNPAAPGKLETRAAGR
LIRTGDRLIALRNNYQLEVFNGDLAYVQSLDPIEQRFRLALDDGRTVDVPFTQADEFGHA
FAISVHRAQGSEFRAVVMPVLTAHYLMLQRNLLYTAITRARELVVLVAQPRAIAIAVRND
RIARRYTALAERLRSLA
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atggccatcacgtcctcgtctccatcccctcccacggcggagctggaaggcacggtcgag
cgcatcacctaccagaacccgagcaacgggtacacggttctgaaggtaaccacccggcgc
ggtgccgaggtgacggtggtcgggcaactcggcggggtcaatcccggcgagacgctgcac
ctagatggattctggaccacacatccacagcacggacgccagttccaggcgacgggcttc
cgctcgatcctcccggcgacgacggagggcatccgcaagtacctcggctccgggctcatc
cgaggggttggcccggtcaccgcacggcgcatcgtcgagcacttcggcgccgaagccctc
gacgtgatcgaccagcagcccgagcgactcagcgaggtgcgcgggttggggccgaagcgg
atcaaggccatcatcgccgcctgggccgagcagcgggcgatcaaggacgtgatggtcctg
ctccagagccttggcgtgcacaccggactggcggtgcgcatttaccgcgagtacggcgac
gacgccctccacatcgtccagaccgacccctaccggctcgcgcgcgatgtctggggcatc
ggcttcaagacggccgacacgatcggccgctcgctgggcatcccccacgacgacccgggg
cggctcgcagccggtgtgcgctacgtcctctcccaggccgccgaccgcgacggccacgtg
tacctcccccgcgacgagctggtgacagccgccgccgaactgctcggctgcgacccggcc
caggtggacgccgtgatcccggatctcgtcgccgcgcgggatgtgttcgtcgaagcgaac
gacggggtggaagcggtctacctcagcgcgctcggcggcgccgagatcgccgtggcgcgg
cgactttcccggctcgccgcggccgatgacgaccggttggccgccttccagagcgtcgat
tgggagcgcgccttcgattggctccaccacacgcagggcatgccacccctggccgcacaa
caggtcgcggccgtgcgcaccgcccttacccagcgcgtgaccgtcctcaccggcgggccg
gggacagggaaaagcaccaccctgcgcgcggtcgtgacgctggcgcgggccaagcgcgcc
agcgtcatcctggccgcgccgaccggccgcgccgccaagcgcatggcggaggtgaccggg
cgcgaggcgcagacgatccaccggctcctgaagctccagcccggcggcgccgccttcttc
aacgaggagaacccgctcccggcggacctggtcgtggttgatgaagcctcgatgctggat
gtcgcgctctgcaacacgctgttgaaagcgatcgagccggggacgcacctgctgctcgtt
ggcgatgtcgaccagctcccatcggtgggcccgggcaatatcctgcgcgacgtgatcgac
agtggcgcagtgccagtggtacggctcgacgaggtcttccggcaggccgagcagagcgcc
atcgtccgcaacgcccatcggatcaaccacggcgagatgccgcagtggggtcgggacatc
cgcgacttcgcggtgctgcgcctccctgaggggcccgacgtcatcgagcgggctgcggag
acgatcatcgagctggtccaggagcggctgccgcgcgcgtacgggctgaaccccggcgag
atccaggtcctcagcccgatgaaccgcggcccagcgggcacccgccggctgaacgagttg
cttcaagaggcgctcaaccccgccgcgcccggtaagctggagacgcgggcggccgggcgg
ctcatccgcaccggagaccgcctgatcgccctgcgcaacaattatcaactcgaggtcttc
aacggcgatctcgcctacgtgcagagcctggacccgattgagcagcggttccggctcgca
ctcgacgacggccgcacggtcgacgtgccgttcacccaggcggacgagttcggccacgcc
ttcgccatctcggtccaccgggcgcagggatcggagttccgtgccgtggtaatgcctgtg
ctgacggcacactacctgatgctgcagcgcaacctgctgtacaccgccatcacgcgcgcc
cgggaacttgtcgtgctcgtcgcccagccccgtgccatcgcgatcgccgtgcgcaacgac
cgcatcgcccgccgctacaccgccctcgccgaacgcctccgctcgcttgcctga

DBGET integrated database retrieval system