KEGG   Sphaerobacter thermophilus: Sthe_0645Help
Entry
Sthe_0645         CDS       T01128                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sti  Sphaerobacter thermophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sti00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:712641..713594
Genome map
AA seq 317 aa AA seqDB search
MGRYEPINALESPRFSGLRTFARLPHVRDLAGVDVAVFGIPFDTATTFRTGARFGPAAVR
EMSAMLRTYNPSLDVNVYDYLSVVDYGDLPTVPGYIEDTYDRVVAAMEPILAENVFPVGI
GGDHSVTLAELRAIARRYGPVGFIQFDSHGDTWDEYFGRKYNHGTPFRRAVEEGLIDTSR
AIQVGMRGSLYGPGDLQQSRDLGFELWTTDDVRREGLPAVLEAIRRRVGSGPVFLTFDID
FVDPSFAPGTGTPEIGGFTSREAQELVRGLVGIDFVGMDLVEVLPAHDPSGITALIAANV
IFEFLSVLAVNRRERAR
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgggccgctacgaaccgatcaacgctctggagagcccgcgcttcagcggactgcgcacc
ttcgcccgcttgccgcatgtgcgcgatctggcgggcgtcgacgtcgcagtgttcggcatc
cccttcgacaccgccaccaccttccgcacgggagcccgcttcgggccggctgcggtgcgc
gagatgtcggccatgctgcgcacctacaacccgtcgctcgacgtcaacgtgtacgactat
ctctcggtggtggactacggcgatctgccgacggtcccgggctacatcgaagacacctac
gaccgggtcgtcgcggcgatggagccgatcctggcggaaaatgtgttcccggttgggatc
ggcggtgaccactcggtgacgctggccgaactgcgggcgatcgcgcggcgctacgggccg
gtgggctttatccagttcgactcgcacggtgacacctgggacgagtatttcgggcggaag
tacaaccacggcacccccttccgccgggcggtggaggaggggctgatcgacacgtcccgg
gccatccaggtcggcatgcgcggttcgctctacgggccgggggacctgcagcagtcgcgc
gacctcggcttcgaactctggaccaccgacgacgtgcgccgcgaggggctgcccgccgtg
ctggaagcgatccggcggcgggtcgggtccggcccggtcttcctgacgttcgacatcgac
ttcgtcgatcccagcttcgctcccggcaccgggacaccggagatcggtggcttcaccagt
cgcgaggcgcaggagctggtgcgtggactggtggggatcgacttcgtgggcatggacctc
gtcgaggtgctgccggctcacgacccaagtgggatcaccgcgctgattgccgccaatgtc
atcttcgagttcctgagcgtgctggcggtcaaccggcgcgagcgcgcccgctag

DBGET integrated database retrieval system