KEGG   Sphaerobacter thermophilus: Sthe_0945Help
Entry
Sthe_0945         CDS       T01128                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sti  Sphaerobacter thermophilus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sti00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sthe_0945
DNA repair and recombination proteins [BR:sti03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sthe_0945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1045733..1046338
Genome map
AA seq 201 aa AA seqDB search
MRSRVTAEPVAKLIDEFGKLPGVGPKTASRLAYHILRSDREEAVALAEAILEVKERIVLC
STCFNITEHDPCPICSDEQRDRRTICVVEEPLDVVALDRTGEYNGLYHVLHGVLSPVDGI
GPDRLRIRELVARVQADPPDEVILALNPNIEGDATAMYIARQLLPLGVTVTRPASGLPVG
GDLEYADEVTLGRALAGRRAL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgcgatctcgggttacggcagaaccggttgccaagctgattgacgaattcggtaagttg
cccggggtaggcccgaagacggcatcgcgcctggcctaccacatcctacggagcgaccgc
gaggaggcggtggcactggcggaggcgatcctcgaggtcaaggagcggatcgtgctctgc
tcgacctgcttcaatatcacggagcacgacccatgtccgatctgctccgatgaacagcgg
gaccgccgcacgatctgcgtggtcgaggagccgctggatgtggtagcgctcgaccggacc
ggcgaatacaacgggctgtatcacgtgttgcatggtgtcctgtcgccggtcgatggaatt
ggcccggaccgattgcgtatccgtgagttggtcgcgcgcgtacaggcggacccgcccgat
gaggtgattttggcgctgaacccgaacattgaaggcgatgccaccgccatgtacattgcg
cggcagttgctcccgctcggcgtcactgtcacccgcccggccagtgggctgccggtgggg
ggcgacctcgagtacgccgacgaagtgacgctcgggcgagcgcttgccgggcgtcgcgcg
ctctga

DBGET integrated database retrieval system