KEGG   Sphaerobacter thermophilus: Sthe_0980Help
Entry
Sthe_0980         CDS       T01128                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5 epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00521  Streptomycin biosynthesis
sti00523  Polyketide sugar unit biosynthesis
sti01130  Biosynthesis of antibiotics
Module
sti_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sthe_0980
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sthe_0980
Enzymes [BR:sti01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sthe_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA Cupin_2 PCO_ADO
Motif
Other DBs
NCBI-ProteinID: ACZ38416
JGI: Sthe_0980
UniProt: D1C2E9
Position
1:complement(1083207..1083662)
Genome map
AA seq 151 aa AA seqDB search
MIHGVEVKRLITHVDERGALTELIRRDDPFFEQFGQCYVSVSYPGVIRGWHYHKKQTDYF
TCVKGMIKVPLYDIREDSPTYGELNEFFIGDDNRIVVKIPAGVLHGFKNIGHEPCYLLNF
PTEPYNPDDPDEYRIPWNSPDIPYNWDIQFK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
gtgatccacggcgtcgaggtcaagcggctcatcacgcatgtagacgagcgcggggcgttg
accgagttgatccgccgcgacgacccgttcttcgagcagttcggccagtgctatgtctcg
gtgagctacccgggcgtgatccgcggttggcactaccacaagaagcagaccgactacttc
acctgcgtcaaggggatgatcaaggtcccgctctacgacatccgtgaggactcgcccacc
tacggcgagttgaacgagttcttcatcggcgacgacaaccgcatcgtcgtgaagatcccg
gccggggtgctccacggcttcaagaacatcggccacgagccgtgctacctgctcaacttc
ccgaccgagccgtacaacccggacgacccggacgaataccggattccctggaactcgccc
gacatcccgtacaactgggatatccagttcaagtag

DBGET integrated database retrieval system