KEGG   Sphaerobacter thermophilus: Sthe_1074Help
Entry
Sthe_1074         CDS       T01128                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sti  Sphaerobacter thermophilus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sti00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1172001..1173509
Genome map
AA seq 502 aa AA seqDB search
MVVSGRTAGILLHPTSLPGPHGVGDLGGSAARFIDWLSEARQGLWQILPLGPPGAGDSPY
DARSSFAGNPLLIALSPLVEWGLLTADEVPPPLMSDPERADFAGATSVKLTALARAFERF
EASGDGELRVAYEEFWERERAWLADYALYAALRTAHDGLPWYRWEPGLVRREPAALAEWR
ARLDREVRFHAFLQFVFDRQWTTLKHYANERGIRIVGDIPIYVSHDSADVWAHQDLFTLD
EAGQPTMRAGVPPDYFSATGQLWGNPCYRWDVLAATGYRWWIDRFRRVRELVDLVRVDHF
RGFAAGWQIPAGEQTAINGAWVPGPGLDFFRRLQSELGPVPIIVEDLGIITPDVHALREQ
LGYPGMRVLQFAFGSGSDNPYLPHNYEADTVVYTGTHDNDTTLGWFRSCPPHERDHALRY
LGTDGHDIVWDLIRLAFMSVASIAVVPLQDVLELGSEARMNVPGTASGNWRWRVREDALT
RERAHRLASLTEIYGRVGGAGQ
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtggtagtgtctggcaggacggcagggatccttcttcacccgacgtcgctcccggggcca
catggggtcggggatcttggcgggtcggcggcgcggttcatcgactggctcagcgaggca
aggcaaggtctgtggcagatcctgccgctggggcctcccggcgccggggactcgccgtac
gacgcgcggtcgtcgtttgcgggcaacccgctgctgatcgcattgtccccgctggtcgag
tggggtctgcttaccgccgacgaggtgccgccaccgctgatgtccgacccggagcgtgcc
gacttcgccggggcgaccagcgtcaagctgaccgcccttgcgcgggcattcgagcgcttt
gaggcaagcggcgatggcgagttgcgcgttgcctatgaggagttctgggagcgggagagg
gcctggctggccgattacgcgctctatgctgcgctgcgcacggcgcacgacggcctgccc
tggtaccgctgggagccgggcctcgttcggcgcgagcccgcagcacttgccgagtggcgg
gcgcggttggaccgtgaggtccgctttcacgccttcctccagttcgtcttcgatcgccag
tggaccactctgaagcactacgccaacgagcggggcatccgtatcgtgggggacatcccg
atctacgtctcccacgacagtgccgacgtatgggcgcaccaggacctcttcaccctggat
gaggcgggccagccgacaatgcgcgccggggttccgcccgactacttctccgcgaccggt
cagctctggggtaacccgtgctaccgctgggatgtgctggccgccaccggctaccgctgg
tggattgaccggttccgccgtgtccgtgagctcgtggatctggtgcgggtggaccacttc
cgggggttcgccgctgggtggcagatcccggccggggagcagacggcgatcaacggcgcg
tgggtacccggtccgggtctggacttcttccgccgtctgcagagcgagctaggccctgtc
ccgatcatcgtggaggatctggggatcatcacgccggacgtccatgcgttgcgggagcag
ctcggctacccgggcatgcgggtcctgcagttcgcgttcggtagcggcagcgacaacccg
tacctcccccacaactacgaggcggacacggtcgtctacaccggaacgcatgacaacgac
actaccctcggctggttccgaagttgcccgccccacgagcgggaccacgctctccgttac
ctggggaccgacggccacgacatcgtttgggatctgatccggctcgcgttcatgtcggtg
gcgagcatagcggtggtcccgctgcaggatgtgctggagctgggcagcgaggcgcgcatg
aacgtcccgggcacggcgagcggcaactggaggtggcgtgttcgcgaggacgcgctcacc
cgagaacgcgcgcatcgcctggcttccctcacggaaatctacggccgtgtgggaggcgcg
ggacagtag

DBGET integrated database retrieval system