KEGG   Sphaerobacter thermophilus: Sthe_1251Help
Entry
Sthe_1251         CDS       T01128                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_1251
   01230 Biosynthesis of amino acids
    Sthe_1251
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_1251
   00051 Fructose and mannose metabolism
    Sthe_1251
   00562 Inositol phosphate metabolism
    Sthe_1251
Enzymes [BR:sti01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sthe_1251
Exosome [BR:sti04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sthe_1251
  Exosomal proteins of bladder cancer cells
   Sthe_1251
  Exosomal proteins of melanoma cells
   Sthe_1251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1382676..1383440)
Genome map
AA seq 254 aa AA seqDB search
MRKPIVAGNWKMNTSLEEARALAGELRSTLSAYSTVERVLIPPFPWIVPLADILDGSDIV
LGAQDCAVEDQGAFTGEVSARMLAPLCRYIIVGHSERRHIIGETDEVVAAKLRAVLRNGA
RPILCVGELLEERERGEARAVVERQLQSAFADVEAADVLRTVIAYEPVWAIGTGRAATPE
DAREMANWIREVLARHVGAEAANEIRVQYGGSVNADNAAGFLSLPEIDGALVGGASLKAD
QFTQIVERAAALRL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcggaagccgatcgttgccggcaactggaagatgaacacctcccttgaggaggcgcgg
gctctggccggggagctgcgttcgacgctgtctgcctactcaacggtcgagcgtgtgctc
atcccgccctttccctggatcgtgccgctggcagatatccttgacgggagcgacatcgtc
ctcggcgcgcaggactgcgccgttgaggatcagggcgccttcacgggggaggtgtcggcg
cggatgctggccccgctgtgccggtacatcatcgtcggccatagtgagcggcggcacatc
atcggggagaccgacgaggtcgtggccgcgaagctccgcgcggtgcttcggaacggcgcc
cgcccgatcctctgtgtcggcgagctgctcgaagagcgggagcgcggcgaggcgcgtgcg
gtcgtggagcgacagctccagagcgctttcgcggatgtcgaggcggccgacgtgctgcgc
accgtcattgcctacgagcccgtttgggcaatcggcaccgggcgggcggcgacgcccgag
gatgcgcgcgagatggcgaactggatccgtgaggtgcttgcgcgccatgtcggcgcggag
gcggcaaacgagatccgggtccagtatggtgggagcgtcaatgccgacaatgcggccggg
ttcctctccttgccagagatcgacggcgctctcgtgggtggtgccagcttgaaggctgac
cagtttacgcagatcgtggagcgggccgctgcgctccggctttga

DBGET integrated database retrieval system