KEGG   Sphaerobacter thermophilus: Sthe_1343Help
Entry
Sthe_1343         CDS       T01128                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_1343
   01230 Biosynthesis of amino acids
    Sthe_1343
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_1343
   00030 Pentose phosphate pathway
    Sthe_1343
   00051 Fructose and mannose metabolism
    Sthe_1343
   00052 Galactose metabolism
    Sthe_1343
  Energy metabolism
   00680 Methane metabolism
    Sthe_1343
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Sthe_1343
Enzymes [BR:sti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Sthe_1343
Protein phosphatases and associated proteins [BR:sti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Sthe_1343
Messenger RNA biogenesis [BR:sti03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Sthe_1343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1483292..1484416
Genome map
AA seq 374 aa AA seqDB search
MAVEGRKRIAVLTGGGDAPGLNAVIRAVTKAAILDHGWSVIGFRDGFEGVIHDRWVELTL
DGVRGILPRGGTILGASNRCNPFSYAAPGDEAPRDYSSEVLRRVEQHGIDALVVIGGDGT
LTVSHHLHTMGAPVVGVPKTIDNDVRGTEVTFGFDTAVNTVTDAIDKLHTTAESHHRVMI
VEVMGRTTGWIALHSGLAGGGDVILIPEIPFKLDAIRATIRRRQALGRHFTIIVVAEGAK
PEGGEAIYEKVGHLPYERRYGGIGEWLRRELAATITQEVRSVVLGHLQRGGSPTARDRVL
GSVLGAAAVDLIAEGALGYMVGVSGDLAGQRPYSVVSVPLSEPSRGPRHVPVDHSAVRTA
REIGISFGDVMPEE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagggacggaagcggattgcggtcctcaccggcgggggagacgcccccggt
ctcaacgcggtgattcgggcagtcaccaaggcggccatcctcgaccacgggtggtcggtg
atcgggttccgcgacggcttcgagggggtcatccacgaccgctgggtcgaactcacgctc
gatggtgtgcgcggcatcctgccacgaggcggcacgatccttggcgcttcgaaccggtgc
aaccccttctcctacgctgcgcccggtgacgaagcgccccgcgactacagcagcgaggtc
ctgcggcgagtcgagcagcacggcatcgacgcgctggtggtcatcggcggcgacggcacc
ctgaccgtctcacaccacctccataccatgggtgccccggtcgtcggcgtgcccaagacg
atcgacaacgacgtgcgcggcaccgaggtcaccttcggcttcgacacagcggtcaacacg
gtcaccgacgccatcgacaagctgcacaccacggccgagagccaccaccgggtcatgatc
gtggaggtcatgggccgcaccaccggctggatcgccctccactctggcctggccggtggc
ggcgacgtgatcctgatcccggagatcccattcaagctcgacgccatccgggcaacgatc
cggcgacgccaggcgctcggccgccacttcactatcatcgtcgtggccgaaggcgcgaag
ccggagggcggcgaggcgatctacgaaaaggtcgggcatctcccctacgagcgccgctac
ggtggcatcggcgagtggctgcgccgcgagttggccgccacgatcacgcaggaggtgcgc
tcggtggtgcttggtcacctccagcggggcggcagcccaaccgcacgcgaccgggtcctc
ggctcggtgctcggggccgccgcggtggatctgatcgcggaaggcgcgctggggtacatg
gtcggcgtcagcggtgatctggccgggcagcgcccgtactccgtggtctccgtaccgctc
tcggagccgagccgtgggccgcggcacgtcccggtcgaccactcggccgtacgaaccgcg
cgcgagatcgggatctccttcggcgatgtaatgccggaggagtga

DBGET integrated database retrieval system