KEGG   Sphaerobacter thermophilus: Sthe_1343Help
Entry
Sthe_1343         CDS       T01128                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:sti01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sti01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sti00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sti00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sti00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sti00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:sti00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1483292..1484416
Genome map
AA seq 374 aa AA seqDB search
MAVEGRKRIAVLTGGGDAPGLNAVIRAVTKAAILDHGWSVIGFRDGFEGVIHDRWVELTL
DGVRGILPRGGTILGASNRCNPFSYAAPGDEAPRDYSSEVLRRVEQHGIDALVVIGGDGT
LTVSHHLHTMGAPVVGVPKTIDNDVRGTEVTFGFDTAVNTVTDAIDKLHTTAESHHRVMI
VEVMGRTTGWIALHSGLAGGGDVILIPEIPFKLDAIRATIRRRQALGRHFTIIVVAEGAK
PEGGEAIYEKVGHLPYERRYGGIGEWLRRELAATITQEVRSVVLGHLQRGGSPTARDRVL
GSVLGAAAVDLIAEGALGYMVGVSGDLAGQRPYSVVSVPLSEPSRGPRHVPVDHSAVRTA
REIGISFGDVMPEE
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcgagggacggaagcggattgcggtcctcaccggcgggggagacgcccccggt
ctcaacgcggtgattcgggcagtcaccaaggcggccatcctcgaccacgggtggtcggtg
atcgggttccgcgacggcttcgagggggtcatccacgaccgctgggtcgaactcacgctc
gatggtgtgcgcggcatcctgccacgaggcggcacgatccttggcgcttcgaaccggtgc
aaccccttctcctacgctgcgcccggtgacgaagcgccccgcgactacagcagcgaggtc
ctgcggcgagtcgagcagcacggcatcgacgcgctggtggtcatcggcggcgacggcacc
ctgaccgtctcacaccacctccataccatgggtgccccggtcgtcggcgtgcccaagacg
atcgacaacgacgtgcgcggcaccgaggtcaccttcggcttcgacacagcggtcaacacg
gtcaccgacgccatcgacaagctgcacaccacggccgagagccaccaccgggtcatgatc
gtggaggtcatgggccgcaccaccggctggatcgccctccactctggcctggccggtggc
ggcgacgtgatcctgatcccggagatcccattcaagctcgacgccatccgggcaacgatc
cggcgacgccaggcgctcggccgccacttcactatcatcgtcgtggccgaaggcgcgaag
ccggagggcggcgaggcgatctacgaaaaggtcgggcatctcccctacgagcgccgctac
ggtggcatcggcgagtggctgcgccgcgagttggccgccacgatcacgcaggaggtgcgc
tcggtggtgcttggtcacctccagcggggcggcagcccaaccgcacgcgaccgggtcctc
ggctcggtgctcggggccgccgcggtggatctgatcgcggaaggcgcgctggggtacatg
gtcggcgtcagcggtgatctggccgggcagcgcccgtactccgtggtctccgtaccgctc
tcggagccgagccgtgggccgcggcacgtcccggtcgaccactcggccgtacgaaccgcg
cgcgagatcgggatctccttcggcgatgtaatgccggaggagtga

DBGET integrated database retrieval system