KEGG   Sphaerobacter thermophilus: Sthe_1676Help
Entry
Sthe_1676         CDS       T01128                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00340  Histidine metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01230  Biosynthesis of amino acids
Module
sti_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Sthe_1676
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sthe_1676
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ACZ39110
JGI: Sthe_1676
UniProt: D1C4E3
Position
1:1846117..1847460
Genome map
AA seq 447 aa AA seqDB search
MTSTVTVRVLHDPAAAREFLLRRRRLEATELPERVRAGIRSIFGADLTAGEVVDRIIADV
RQEGDAALRRYTRLLDGAELDRLEVAPEEIAAATAEVPSDVLEALRFARDRIDAFHRRQL
RSSWMHFDEDGALGQIIRPLERVGIYTPGGRAPYPSSLLMSAVPARVAGVEEIIVCAPPE
RDGRISPLILAAADIAGVDRVFKVGGAQAIAAMAYGTESVPRVDKILGPGNIFVVLAKRR
VYGEVDIDQLPGPTETLLIADESADPALCAADLLAQAEHDPLASPILLTTSAQLAEAVKQ
ELTAQLPALERAEIAGEALVNNGLIAVVPDLPTAFDLANAYAPEHLCLLLAEPWAHLDRV
RHAGGVFLGESSPEVLGDYTAGPSHVMPTGQTARFSSPINVEEFLKIISVVGINREGLKR
LGPAAATLARAEGLTAHARAIERRLGS
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcaccgtcaccgtccgcgtcctgcacgacccggccgccgcgcgggagttcctg
ctgcgacggcgtcgcctggaggcgaccgagcttccggagcgggtgcgggccgggatccgc
tccatcttcggcgcggaccttaccgcgggggaggtggtggaccggatcatcgccgacgtc
cgccaggagggggacgcagccctgcgccgctacacgcgcctcctcgacggcgctgagctc
gaccggctggaggtcgcgccggaggagatcgctgcggcgaccgctgaagtaccgtcggac
gtcttggaggcgctacgcttcgcccgcgaccggatcgacgccttccaccgccgccagctc
cgctcctcctggatgcactttgacgaggacggcgcactcgggcagatcatccggccgctg
gagcgggtcgggatctacacccctggaggccgggcgccctacccgtcctcgctgctgatg
tccgccgtgccggcccgtgtggcgggcgtcgaggagatcatcgtctgcgctccgccggag
cgggacggccgcatctcgccgttgatcctggcggcggccgacatcgcgggggtcgatcgg
gtcttcaaggtcggtggggcgcaggctattgccgcgatggcctacggtactgaaagcgtg
ccgcgcgtcgacaagatcctcggcccgggcaacatcttcgtcgtcttggccaagcgccgc
gtctacggcgaggtggatatcgaccagctccccgggccgaccgagacgctcctcatcgcc
gacgagagcgccgacccggcgctgtgcgctgccgacctgctggcacaggccgagcacgac
ccgctcgccagtccgatccttctcacgacctcggcccagcttgccgaggctgtcaaacag
gaactgaccgcccagctcccggcgctggagcgggccgagatcgccggcgaggcgctggtg
aacaacgggctcatcgcggtcgtgcccgacctccccacggcgttcgacctggcgaatgcc
tatgctccggagcacctctgcctgctcctggccgagccctgggcgcacctcgaccgggtg
cggcatgccggtggggtcttcctgggagagtcgtcgcccgaggtcctgggcgactacact
gccggcccgagccacgtcatgccgaccgggcaaaccgcccgcttctcctcgccgatcaac
gtcgaggagttcttgaagatcatcagcgtcgtggggatcaaccgcgagggactgaaacgt
ctcggtcccgcggcagccaccctcgcccgtgctgagggcctcaccgcccacgcacgcgcc
atcgagcgccgactggggtcgtag

DBGET integrated database retrieval system