KEGG   Sphaerobacter thermophilus: Sthe_1783Help
Entry
Sthe_1783         CDS       T01128                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00020  Citrate cycle (TCA cycle)
sti00640  Propanoate metabolism
sti00660  C5-Branched dibasic acid metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
Module
sti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sthe_1783
   00640 Propanoate metabolism
    Sthe_1783
   00660 C5-Branched dibasic acid metabolism
    Sthe_1783
Enzymes [BR:sti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sthe_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A RAB3GAP2_C Citrate_bind ATP-grasp Pox_M2
Motif
Other DBs
NCBI-ProteinID: ACZ39217
JGI: Sthe_1783
UniProt: D1C4Q0
Position
1:1964747..1965886
Genome map
AA seq 379 aa AA seqDB search
MNIHEYQAAEILKGYGIPINQGIVATTPDEVAAAAGQLGGTVVVKAQVHTGGRGKAGGVK
LAHSPEEAREVGSRILGMDIRGHTVHKVLVAPGVDIAREYYLGVVIDRAARGITIMASSA
GGVDIEEVARETPEKIHREAANPFLGFHDYQARRLAFKLGIEPDLVGGFARIARQLFEAF
VQSDASLAEINPLVLTADRTWLALDSKITIDDSALVRHPDLEQLRDLQEENATELEARAA
GISFVKLDGNIGCVVNGAGLSMATMDAIKHYGGEPANFLDVGGGASAEQVEKALRLVLAD
SNVRAVLINIFGGITRCDEVARGLLAAMDAVKPTVPFVIRLVGTNQDEGRRILADAGITV
VDTMPEAAERVVAAASGAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtaccaggctgccgagatcctcaaggggtacggcatcccaatcaac
caggggatcgtcgcgaccacgccggacgaggtcgcagcagcggctgggcaactcggcggt
acggtggtagtcaaggcgcaggtgcataccggcgggcgcggtaaagcgggtggagtcaag
ctggcgcattcgccggaggaagcccgggaagttggcagccgcatcctgggcatggatatc
cgcggccacaccgtgcacaaggtgctggtcgcgccgggcgtggacatcgcacgggagtac
tatctcggggtcgtgatcgaccgcgccgcccgcggtatcacgatcatggcaagcagcgcg
ggtggggtcgacattgaagaggtggcccgcgagacgcccgagaagatccaccgcgaagcg
gcgaatcccttcctcggtttccacgactaccaggcccgccgcctggcgttcaagctgggg
atcgagccggacctcgtcggcggcttcgcccggatcgcccgccagctcttcgaggcattc
gttcagtccgacgcctcgctggcggagatcaacccgctggtgctcaccgcggaccggacc
tggctggcgctcgactccaagatcactatcgacgatagcgcgctggtccgccatccggac
ctggagcaactgcgcgacctgcaggaggagaacgcgactgagctggaggcgcgtgcagcc
gggattagcttcgtcaagctcgacggcaacatcggctgcgtcgtcaacggtgccgggctc
tcgatggcgaccatggacgccatcaagcactatggcggcgagccggccaacttcctcgac
gtcggcggcggcgcgagcgccgagcaggtggagaaagcactgcggctggttctggccgac
tccaacgtgcgggctgtgctgatcaacatcttcggcggcatcacgcgctgtgacgaggtc
gcgcgcgggctgctcgccgccatggacgcggtcaagccgacggtccccttcgtcatccga
ctggtcggcaccaaccaggacgaggggcgccgcatcctggcggatgcggggatcacggtg
gtcgatacgatgccggaagcggccgagcgggtcgtcgcggcggcaagcggcgcggcctaa

DBGET integrated database retrieval system