KEGG   Sphaerobacter thermophilus: Sthe_1783Help
Entry
Sthe_1783         CDS       T01128                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sti  Sphaerobacter thermophilus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_1783
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sthe_1783
   00640 Propanoate metabolism
    Sthe_1783
   00660 C5-Branched dibasic acid metabolism
    Sthe_1783
Enzymes [BR:sti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sthe_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1964747..1965886
Genome map
AA seq 379 aa AA seqDB search
MNIHEYQAAEILKGYGIPINQGIVATTPDEVAAAAGQLGGTVVVKAQVHTGGRGKAGGVK
LAHSPEEAREVGSRILGMDIRGHTVHKVLVAPGVDIAREYYLGVVIDRAARGITIMASSA
GGVDIEEVARETPEKIHREAANPFLGFHDYQARRLAFKLGIEPDLVGGFARIARQLFEAF
VQSDASLAEINPLVLTADRTWLALDSKITIDDSALVRHPDLEQLRDLQEENATELEARAA
GISFVKLDGNIGCVVNGAGLSMATMDAIKHYGGEPANFLDVGGGASAEQVEKALRLVLAD
SNVRAVLINIFGGITRCDEVARGLLAAMDAVKPTVPFVIRLVGTNQDEGRRILADAGITV
VDTMPEAAERVVAAASGAA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcacgagtaccaggctgccgagatcctcaaggggtacggcatcccaatcaac
caggggatcgtcgcgaccacgccggacgaggtcgcagcagcggctgggcaactcggcggt
acggtggtagtcaaggcgcaggtgcataccggcgggcgcggtaaagcgggtggagtcaag
ctggcgcattcgccggaggaagcccgggaagttggcagccgcatcctgggcatggatatc
cgcggccacaccgtgcacaaggtgctggtcgcgccgggcgtggacatcgcacgggagtac
tatctcggggtcgtgatcgaccgcgccgcccgcggtatcacgatcatggcaagcagcgcg
ggtggggtcgacattgaagaggtggcccgcgagacgcccgagaagatccaccgcgaagcg
gcgaatcccttcctcggtttccacgactaccaggcccgccgcctggcgttcaagctgggg
atcgagccggacctcgtcggcggcttcgcccggatcgcccgccagctcttcgaggcattc
gttcagtccgacgcctcgctggcggagatcaacccgctggtgctcaccgcggaccggacc
tggctggcgctcgactccaagatcactatcgacgatagcgcgctggtccgccatccggac
ctggagcaactgcgcgacctgcaggaggagaacgcgactgagctggaggcgcgtgcagcc
gggattagcttcgtcaagctcgacggcaacatcggctgcgtcgtcaacggtgccgggctc
tcgatggcgaccatggacgccatcaagcactatggcggcgagccggccaacttcctcgac
gtcggcggcggcgcgagcgccgagcaggtggagaaagcactgcggctggttctggccgac
tccaacgtgcgggctgtgctgatcaacatcttcggcggcatcacgcgctgtgacgaggtc
gcgcgcgggctgctcgccgccatggacgcggtcaagccgacggtccccttcgtcatccga
ctggtcggcaccaaccaggacgaggggcgccgcatcctggcggatgcggggatcacggtg
gtcgatacgatgccggaagcggccgagcgggtcgtcgcggcggcaagcggcgcggcctaa

DBGET integrated database retrieval system