KEGG   Sphaerobacter thermophilus: Sthe_1847Help
Entry
Sthe_1847         CDS       T01128                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sti  Sphaerobacter thermophilus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sthe_1847
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sthe_1847
Enzymes [BR:sti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Sthe_1847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2034335..2035267
Genome map
AA seq 310 aa AA seqDB search
MMSGSRSARSILAVQQFDRPFLEQLFARADEMRVIVAAGGSNRLSGRIMATLFFEPSTRT
RLSFESAMIRLGGQVLSAEYARETSSAAKGETIEDTARIVESYADVIVIRHPEAGSAARA
ASVIDIPVINAGDGPHEHPTQALLDLYTIRSELGRIDDLRIALVGDLKYGRAARSLALIL
TQCRGIELTFVSPPNVRMGNDVTAALAAAGVRFREESDLSRVLPEVDVVYQTRIQHERFT
SEEEYEAARGLYVIDAASLRLMHPNAILMHPLPRVDEIAPEVDLDPRAAYFRQAKNGVYI
RMALLDMLLG
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatgtccgggtcgcggagtgcgcgcagtatcctcgccgtgcagcagttcgaccgcccc
ttcctcgaacagctcttcgcgcgcgccgacgagatgcgcgtgattgtggctgccggcggc
tccaaccggctcagcggccggatcatggcgaccctcttcttcgaaccgagcacgcgcacg
cgcctgagcttcgagtcggcgatgatccggctcggcgggcaggtcctctcggccgagtac
gcccgggagacctcgtctgcggccaagggggagaccatcgaggataccgcgcgcatcgtc
gagtcgtacgccgacgtcatcgtcatccgccacccggaggccggctccgccgcccgcgct
gcgtcggtgatcgacatcccggtcatcaacgccggggatgggccacacgagcacccgacc
caggcgctgctcgacctctacaccatccgctcggagctcggccggatcgacgacctgcgc
atcgccctcgtcggcgacctcaagtacggtcgtgcggcccgctcgctcgccctcatcctg
acgcagtgccgggggattgagttgaccttcgtctcaccgccgaacgtccgcatgggcaac
gacgtcaccgccgcgctggcggcagccggggtccgcttccgcgaggagagcgacctgtcg
cgggtcctgccggaggtcgacgtcgtctaccagacccgcatccagcacgagcgcttcacc
tcggaggaggagtacgaggccgcgcggggactctacgtcatcgacgccgcgagcctccgc
ctgatgcatccgaacgcgatcctgatgcacccgctgccccgcgtggacgaaatcgccccc
gaggtcgatctcgacccgcgcgccgcctacttccggcaggccaagaacggcgtctacatc
cgcatggccctgctcgacatgctcctggggtag

DBGET integrated database retrieval system