KEGG   Sphaerobacter thermophilus: Sthe_1872Help
Entry
Sthe_1872         CDS       T01128                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sthe_1872
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_1872
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sthe_1872
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sthe_1872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:complement(2068410..2069213)
Genome map
AA seq 267 aa AA seqDB search
METKTGSRIAATFARLREAGETGVCPYVTVGYPELDTVGRVGPALVAGGAAMIELGIPFS
DPLADGATVQHSSHVALTNGVTVATCLEAARDLRHKGVDVPLIFMGYFNPLLSYGLERFA
AACAEAGADGVIVPDLPPDESGDLREALQRHGLDLIFMLAPTSTDAQIAAVARQASGFVY
CVSLTGVTGARDRLSQQLPGFISRVRQHTDLPLVVGFGISTPEHVAEAGKLAEAVAVGSA
VIKRLGETPRERQPDEMEAFIRYLRGA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggagacgaagacagggagccggatcgcggcgacgttcgcacggctgcgggaggctggg
gaaaccggcgtctgcccgtatgtgacggtcggttacccggagctggacaccgtcggccgg
gtcgggccggcgctggtggccgggggcgcggccatgatcgagctgggcatccccttctcc
gaccccctggccgacggcgcgaccgttcagcactcgagccacgtggcgctgaccaacggg
gtcacggtggcgacctgccttgaagcggctcgtgatctacgtcacaagggcgttgacgtg
cccttgatcttcatgggatacttcaaccccctgctcagctacggtcttgagcggttcgcc
gcggcatgtgctgaagcaggggctgatggggtcatcgtgccggacctgcctccggacgag
agcggggacctgcgggaggcgctgcagcggcacgggctggacctcatctttatgctcgct
ccgacgagcaccgatgcgcaaatcgcggcggtcgcccggcaggccagcggcttcgtctac
tgcgtctcgctcaccggggtcaccggggcgcgtgatcgcttgtcgcagcaactgccgggg
ttcatttcgcgcgtacgccagcataccgaccttccgctcgttgtcggcttcggcatctcg
acgccggagcacgtggcggaggccgggaagctggcagaggcggtggccgtcgggagcgct
gtgatcaagcggctgggcgagacgccacgtgagcgccagcccgacgagatggaggcgttc
atccgatacctccgcggcgcctga

DBGET integrated database retrieval system