KEGG   Sphaerobacter thermophilus: Sthe_1873Help
Entry
Sthe_1873         CDS       T01128                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00260  Glycine, serine and threonine metabolism
sti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01130  Biosynthesis of antibiotics
sti01230  Biosynthesis of amino acids
Module
sti_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_1873
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sthe_1873
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sthe_1873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACZ39306
JGI: Sthe_1873
UniProt: D1C4Y9
Position
1:complement(2069213..2070436)
Genome map
AA seq 407 aa AA seqDB search
MTSMTTGRPPAAALPDERGRFGQFGGTYAPVTLLPAIEELREAYDAARRDPEFQAELERL
LATYVGRPTALYYAESLSREIGGAQIYLKREDLAHTGAHKINNALGQGLLAKRMGKPRVI
AETGAGQHGVATATVCAMLGLECVVYMGEVDIARQSLNVFRMKLLGAEVRPVGTGSRTLK
DAMNEAIRDWVTNVETTYYLIGSVAGMHPYPLMVRDFQSVIGRETRRQILEQAGRLPNAV
VACVGGGSNAMGIFHPFVDDPGVELHGAEAAGLGIESGKHAATLSAGRVGVLHGSRSYVL
QDDDGQIIEAHSIAAGLDYPGVGPEHSYLKDTGRATYHPITDAEALEGFKLLCRTEGIIP
ALESAHAVALGARLAADRSPDDIIVINLSGRGDKDMHTLAEALGVAL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcatgaccaccgggcggccaccggccgccgcgctgccggacgagcggggccgc
ttcggccagttcggcggcacgtacgcgccggttacgctattgcccgccatcgaggaactg
cgcgaggcctacgacgccgcgcggcgtgacccggaattccaggctgagctggagcgcctc
ttggcgacctatgtcggccgaccgacggcgctctactacgccgagtcgttgagccgggag
atcggcggggcgcagatctacctcaagcgggaggatctggcgcacaccggtgcccacaag
atcaacaacgcgctcggccagggcctgctggccaagcgcatgggcaagccgcgcgtcatc
gccgagaccggcgccggtcagcacggggtggcgaccgccaccgtctgcgccatgctcggg
ctggagtgcgtcgtctacatgggcgaggtggacatcgcgcggcagtcgctcaacgtcttc
cgcatgaagctcctcggcgccgaggtgcggccggtcgggaccggcagccgcacgctcaag
gacgccatgaacgaggcgatccgcgactgggtcaccaacgtcgagaccacctactacctc
atcggctcggtggccggcatgcacccctaccctttgatggtgcgggactttcagtccgtg
atcggccgcgagacccggcgacagatcctcgagcaggcagggcggctgccgaacgcggtc
gtggcctgcgtcggcggcggttcgaacgcgatggggatcttccaccccttcgtcgacgac
cccggcgtcgagctccacggcgctgaggcggccgggctggggatcgagagcggcaagcac
gccgccaccctgagcgccgggcgggtcggcgtgctccacggctcgcgctcctacgtcctt
caggacgatgacgggcagatcatcgaggcccacagcatcgccgccgggcttgactaccct
ggtgtcggcccagagcacagctatctcaaagacaccgggcgggccacgtaccacccgata
accgacgccgaggcgctggagggcttcaagctgctctgccgcactgaggggatcatcccg
gcgctggagtcggcgcacgccgtggcgctcggcgcgcggctggcggcggaccgttcgccg
gacgacatcatcgtgatcaacctgtcgggtcggggcgacaaggacatgcacaccctcgcc
gaggcactgggagtggcgctgtaa

DBGET integrated database retrieval system