KEGG   Sphaerobacter thermophilus: Sthe_1875Help
Entry
Sthe_1875         CDS       T01128                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01130  Biosynthesis of antibiotics
sti01230  Biosynthesis of amino acids
Module
sti_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sthe_1875
Enzymes [BR:sti01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sthe_1875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PDZ IMPDH
Motif
Other DBs
NCBI-ProteinID: ACZ39308
JGI: Sthe_1875
UniProt: D1C4Z1
Position
1:complement(2071224..2072027)
Genome map
AA seq 267 aa AA seqDB search
MGTETGTILDRIAERTAADLAERRATRPLADLEAMARAMPAPLPLDAALRGTTTRVIAEV
KRASPSKGALAAGVDARAVARDYLAAGAAAISVLTDAPFFQGSLEDLALVAELAHADPTP
RPVLRKDFLLDPYQVVEARAYGADAVLLIVAVLGGASLPEMLDAVHAQGMQALVEVHDEA
ELDVALAAGARIIGINNRDLRNFTVDLGTTERLAPRIPRDRVIVAESGIHGPGDVRRLAA
AGAHAVLVGESLMVAADRQAALRGLLA
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgaaacgggcacgatcctggaccggatcgccgagcggacggcggccgacctg
gcggagcgccgggcgacccggccgctggcggatctcgaagcgatggcgcgggcgatgccg
gccccactcccgctcgatgcagcgctacgggggaccacgacccgcgtcatcgctgaggtg
aagcgcgcctcgccctcgaagggggcgctggcggcgggcgtcgacgcccgcgccgtggcg
cgggactacctcgccgcgggcgcggccgccatctcggtgctcaccgacgcacccttcttc
cagggcagcctggaggacctggcgctggtggccgagctggcgcatgccgacccgacgcca
cgtccggtgctgcgcaaggacttcctgctcgacccgtatcaggtggtcgaggcacgggcg
tacggcgccgatgccgtactgctcatcgttgccgtgctgggcggcgcgtcgctgcccgaa
atgctggacgcggttcatgcccaggggatgcaggcgctggtcgaggtccacgacgaagcg
gagttggacgtggcactcgcggccggcgcgcggatcattgggatcaataatcgcgatctt
cggaacttcaccgtcgacctgggcacgaccgagcgccttgcgccgcgcatcccgcgcgac
cgggtcatcgtggccgagagcggcatccacgggccgggcgatgtgcggcgcctcgcggcg
gccggggcccacgcggtgctcgtcggcgagtcgttgatggtggcggccgatcggcaggcc
gcgttgcgagggctgctggcgtga

DBGET integrated database retrieval system