KEGG   Sphaerobacter thermophilus: Sthe_1920Help
Entry
Sthe_1920         CDS       T01128                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sti  Sphaerobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sti00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2123918..2124469
Genome map
AA seq 183 aa AA seqDB search
MDRERIAAAVAEILRAIGEDPDRPDLRRTPRRVADLFAEMFGGLAIDPRTYLAGALPEEH
GELVVIHDVTVRSMCEHHLVPMVGLAHVAYLPAGRIAGFDRIVKVVDAYARRPQIQERLT
RQVADTIDEMLSPAGVAVRFELEHMCMTIRGSRRPGSRVVTTAYRGVFRDDPAWRAEFHA
ALE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggaccgggagcgcatcgccgccgccgtcgctgagatccttcgtgccatcggggaggac
cccgaccgtcccgacctgcgccgtacgccgcggcgcgtcgccgacctcttcgccgagatg
ttcggcgggctggccatcgatccacgcacctacctggcgggcgcgctacccgaggagcac
ggcgaactggttgtgatccacgatgtcaccgtgcgctcgatgtgcgagcaccacctcgtg
ccgatggtcggcctggcacacgtggcctacctaccggccggccgcatcgccgggttcgac
cggatcgtcaaggtggtcgatgcctacgcacgccgtccgcagatccaggaacgcctcacg
cggcaggtggcggacaccattgatgagatgctgtcaccggccggggttgcggtgcgcttc
gagttagagcacatgtgtatgacgatccggggctcgcgtcgcccaggcagccgcgtggtc
acgacggcttaccgcggtgtcttccgcgacgaccccgcctggcgcgccgagttccatgca
gcgttggagtag

DBGET integrated database retrieval system