KEGG   Sphaerobacter thermophilus: Sthe_1921Help
Entry
Sthe_1921         CDS       T01128                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sti  Sphaerobacter thermophilus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sti00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2124589..2125425
Genome map
AA seq 278 aa AA seqDB search
MSTTLAPLRTPTFTWEWGRRTYVMGIVNVTPDSFSGDGLAGQLDAVVERARAMIAAGADV
IDVGGESTRPGYTPVPAEEELRRVIPAIEALADAIDVPISIDTSKAVVAEAALKAGAHIV
NDIRGLSADPEIAAVAAAAGAPVVIMHDLKIETEDRLIPDIVRELSLRIERALAAGIPWE
HIIIDPGFGFGKTAELNLVLLRRLRELTVLGRPILAGTSRKSTIGRVLGTDPDDRVEGTA
ATVALAIANGADIVRVHDVPQMVRVARMTDAVVRGWSE
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgacgacgctcgcacccctgcgcacacccaccttcacctgggagtggggccggcgg
acttacgtcatgggcatcgtcaatgtgacgcccgactcgtttagcggcgacggcctggcc
ggtcaactcgacgcggtcgtcgagcgcgcccgggctatgatcgccgcgggcgctgacgtg
atcgatgtcgggggagagtcgacccgtccgggctacacgccggttccggccgaggaggaa
ctgcgccgcgtcatcccggccatcgaggccctggcggacgcgatcgacgtgccgatctca
atcgacacctccaaggcagtcgttgccgaggccgctctcaaggccggtgcccatatcgtg
aacgacatccgcgggctgagcgccgaccccgagatcgccgccgtcgcggccgcggccggg
gcacccgtcgtcatcatgcacgacctgaagatcgagacggaggatcggctgatccccgac
atcgtgcgcgaactcagcctgcgcatcgagcgcgcgctcgccgccggcatcccctgggag
cacatcatcatcgaccccggtttcggctttggtaagacggccgagttgaacctggtcctc
ctccggcggctgcgggagttgaccgtgctcggccgccccatcctggccggcacctcgcgc
aagagcaccatcggccgcgtgctcgggaccgacccggacgaccgggtcgaggggaccgcc
gccacggtggcactcgccatcgccaatggggctgacatcgtccgggtgcacgacgtgccg
cagatggtccgcgtggcgcgcatgaccgacgccgtcgtacgtggatggagcgagtga

DBGET integrated database retrieval system