KEGG   Sphaerobacter thermophilus: Sthe_1933Help
Entry
Sthe_1933         CDS       T01128                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00010  Glycolysis / Gluconeogenesis
sti00020  Citrate cycle (TCA cycle)
sti00620  Pyruvate metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
Module
sti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_1933
   00020 Citrate cycle (TCA cycle)
    Sthe_1933
   00620 Pyruvate metabolism
    Sthe_1933
Enzymes [BR:sti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sthe_1933
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ACZ39365
JGI: Sthe_1933
UniProt: D1C548
Position
1:complement(2139946..2141277)
Genome map
AA seq 443 aa AA seqDB search
MAKTVVMPQMGYDMDAGTLLRWLKQEGERVERGEPIAEIETDKVNLEIESFESGVVRKHL
VSEGATVPVGQAIAIVGDPDEPIDVPETPAQTEATVPEAGTPAAPSPTDGVREAPQPESQ
PQPVAQVVERAPGERVRASPLVRRLAAEHGIDLSTVAGSGPGGRIVKEDIMPLIGRPAAP
AAAPEPAAPAEPAAAPAAPAAPVAAPAAVAAPPGAPPSELRDLSRMRQTIARRMTESFQA
PHFYVTTTVDMGAALALREQINEQVEAEQKVSVNDLIVRATALALRKFPMLNASFAGDQV
RVYERIDIAIAVAVEGGLITPFIPDTDRKSLGEIATITKDLIQRAREGGLRPEEYQGGTF
TISNLGMYDVESFIAVINPPQAGILAVGSIRKEPVYQDGVFVPVDLMRITISADHRVTDG
AEAARFLAEVKRYLEKPMLLAIS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtcgtgatgccccagatgggctacgacatggatgcagggacgctcctg
cgctggctgaagcaggagggcgaacgggtcgagcgtggcgagccgatcgccgagatcgag
acggacaaggtcaacctggagatcgagtcgttcgagtccggcgtcgtgcgcaagcacctc
gtcagcgagggcgcgaccgtcccggtcggccaggcgatcgccattgtcggcgacccggac
gagccgatcgacgtgccggagacccctgcgcagaccgaggcgacggtgcccgaagccggc
acccccgccgcccccagcccgactgacggtgtccgcgaggcgccacagccggagtcccag
ccccagccggtggctcaggtggtcgagcgggcgccgggcgagcgcgtgcgtgcctcgccg
ctggtccgccgtctggccgccgagcacggcatcgacctgagtaccgtggcaggctccgga
cccggcggacggatcgtcaaggaagacatcatgccgctgatcggccgcccggccgctccc
gcggctgcgcccgagccggcggccccggccgaacccgccgctgccccggctgctccggcc
gcgccggtcgcagcgcccgcagcagtggccgcgcccccaggcgcgccgccgagcgagctg
cgcgacctctcgcgcatgcgccagaccattgcccggcgtatgaccgagagcttccaggcg
ccccacttctacgtcaccaccacggtggacatgggcgccgcgctcgccctgcgcgagcag
atcaacgagcaggtcgaggcggagcagaaggtctcggtcaacgacttgatcgtccgggcc
acggcgctggcgttgcgcaagttcccgatgctcaacgccagcttcgcgggcgaccaggtg
cgcgtctacgagcggatcgacatcgccatcgccgtcgcggtggagggcgggctcatcacc
ccgttcatccccgacaccgaccgcaagtcgctgggcgagatcgcgacgatcactaaggac
ctgatccagcgcgcccgcgagggcgggctgcgccccgaggagtaccagggcggcacgttc
accatcagcaacctcggcatgtacgatgtcgagagcttcatcgctgtcatcaacccgccg
caggcggggatcctggccgtcggcagcatccgcaaggagccggtctatcaggacggcgtg
ttcgtgccggtcgacctgatgcgcatcacgatctcggccgaccaccgggtcaccgacggt
gccgaggcggcgcggttcctggcggaggtcaagcgctaccttgagaagccgatgctgctg
gccatcagctag

DBGET integrated database retrieval system