KEGG   Sphaerobacter thermophilus: Sthe_1954Help
Entry
Sthe_1954         CDS       T01128                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01438  
acetylornithine deacetylase [EC:3.5.1.16]
Organism
sti  Sphaerobacter thermophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Sthe_1954
   01230 Biosynthesis of amino acids
    Sthe_1954
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Sthe_1954
Enzymes [BR:sti01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     Sthe_1954
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2167268..2168527
Genome map
AA seq 419 aa AA seqDB search
MIDRVMQAVDDLWDAEVQFLQGLVRRPSTLHHEAEIQNWIARELAEMGLEVDRWEIDPGA
LKSLPGYSPVEWSYHGRPNLVGTLRGSGGGKSLLLNGHVDVVSVEPIHFWSHDPWGGEIV
DGRMYGRGSADMKSGIAAMIFAVKALQRAGVRLKGDVYLNTVIEEECTGAGALSTIARGY
RADAVVIPEPFGQTALISQVGVLWARVTVRGAGAHARSASAATNAIFKALPLLQAVKELE
AEVNRPEAKPAVWRDIPHPINYNVGQFHAGDWTSTVPAEAVFEVRIGTYPGENLEDVKAR
FKDRIMEAARRDPWLRDHLPEVIFYAFHAEGADFDPNQEIFAALADAHQAVTGTPIRHEV
TTATTDARFFQLYQGVQTTCYGPSGDNLHAADEWVDLESVRSVTKVLARLMMDWCGADA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaccgcgtgatgcaggcagtcgatgatctctgggatgccgaagtccagtttctc
cagggtctcgtccgtcgtccgagtacgcttcaccatgaagcggagatccagaactggatc
gcacgtgagctggcagagatggggcttgaggttgatcggtgggaaatcgacccaggcgcc
ctgaagtctcttcccggctacagtccagtcgagtggtcatatcatggccgacccaacctc
gtcggcaccctgcggggcagcggtgggggcaaatccctcctgctgaacggccacgtcgat
gtcgtcagcgtggagcccatccacttctggtcgcacgacccgtggggcggagagatcgta
gacggacgcatgtacggccgcggatcggccgacatgaagtcgggcatcgccgccatgatc
ttcgcggtcaaggcccttcaacgggccggagtccggctgaagggtgacgtgtacctcaac
accgtcatcgaagaggagtgcacgggtgcgggagcgctctcgaccatcgcgcgagggtac
cgcgccgatgccgtcgtcatcccggagccgttcggccagacggcgctgatctcgcaggtt
ggggttctctgggctcgcgtcaccgtccgtggggcgggagcacacgcgcgcagcgccagt
gccgcaacgaatgccatcttcaaggcgctgcctctactccaagcggtgaaggagctggag
gcagaggtcaaccgcccggaggccaagccggctgtttggcgggacattccccacccgatc
aactacaacgtcgggcagttccacgcgggcgattggacctcgaccgtgccggccgaggcc
gtcttcgaggtgcggatcggcacgtatcctggcgagaacctggaagacgtcaaggcgcgc
ttcaaggaccgcatcatggaggctgcccgccgcgacccgtggctgcgtgaccacctcccc
gaggtgatcttctacgccttccatgccgagggggccgatttcgatccgaaccaggagatc
ttcgcagcgctcgccgacgcacaccaggcggtcaccggcaccccgatccgccatgaggtc
accacggcgacgaccgacgcgcgcttcttccagctctaccagggagtccagaccacctgc
tacggcccgagcggcgacaacctccacgccgctgatgagtgggtcgatctcgaaagcgtg
cgctcggtgaccaaggtcctcgcgcggttgatgatggattggtgcggtgctgacgcctga

DBGET integrated database retrieval system