KEGG   Sphaerobacter thermophilus: Sthe_2057Help
Entry
Sthe_2057         CDS       T01128                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sti  Sphaerobacter thermophilus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_2057
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sthe_2057
  Amino acid metabolism
   00310 Lysine degradation
    Sthe_2057
Enzymes [BR:sti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sthe_2057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2284729..2286057)
Genome map
AA seq 442 aa AA seqDB search
MPVEIRVPQLGESVVDAVVGTWLKKEGDPVQVGETLVELETDKVNVEITAEQSGVLAKIL
KPEGETVAVGEVIGAIVEAEAAAAPAPAAAAEAPAAPAPAPAREPEPEPVAVPAAPGGPR
ATPAVRRLAAEYDIDLAQVPASGEGGRVTREDVLAYIQRAGRTREAAPAAPANGAEAPAA
PAPAPTPAAPAAPAAPAAPSALPFEIAADGRREERVRMTRRRQTIAQRLVEAQHTAAMLT
TFNEVDMSAVMELRKRRGESFQQRHGVKLGFMSFFTKAVVGALKAFPYLNAEIQGNEIVL
KHYYDIGIAVGAEEGLVVPVVRDADRKSFAEIEREILDLATRAREGKLQLQELMGGTFTI
TNGGVYGSLLSTPILNPPQVGILGMHKIEQRPVVVDGEIVIRPMMYLALSYDHRIVDGSD
AVRFLVRVKELIEDPESLLLEG
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgccggttgagattcgagtgccacaactcggtgagtcggtcgtcgatgcggtcgtcggc
acctggctcaagaaagaaggagacccggtccaggtcggcgagacgctggtcgaactcgaa
accgacaaggtcaacgtcgagatcacagccgagcagtctggggtgctggcgaagatcctc
aagccggagggggagacggtggccgtcggcgaggtgatcggggccatcgtggaagcggag
gctgccgccgctccggcgcctgctgcggcagccgaggccccggcggctccggccccggcc
ccggcgcgggagccagagcccgaaccggtcgctgtcccggccgcgccgggtgggccgcgc
gcgaccccggcggttcgccgcctcgcggcggagtacgatatcgacctggcgcaggtgccg
gccagtggtgagggtggccgggtcacccgcgaggacgtgcttgcgtacattcagcgcgcg
ggacgcacccgcgaggccgcgccggccgccccggccaacggcgccgaggcacccgcggcg
ccggcaccggcgcccactccggccgcgcctgctgcgcccgctgcaccggcggcgccgagc
gcactgccgttcgagatcgcggccgacggccgccgcgaagagcgcgtccgcatgacccgg
cggcggcagaccatcgcccagcggctggtcgaggcccagcacaccgccgccatgcttacg
accttcaacgaggtcgacatgagcgccgtcatggagctgcgcaagcggcgtggcgagtcc
ttccagcagcggcacggggtcaaactcggcttcatgtccttcttcaccaaggctgtcgtc
ggcgcgctcaaggcgttcccgtacctcaacgccgagatccaggggaacgagatcgtcctg
aagcactactacgacatcggcatcgccgttggcgccgaggagggcctggtggtgcccgtg
gtgcgcgacgccgaccgcaagagcttcgctgagatcgagcgggagatccttgatctcgcc
acgcgggcgcgcgagggcaagctccagctccaggaactgatgggcggcaccttcaccatc
acgaacggcggcgtctacggctcgctcctgagcacgccgatcctcaacccgccgcaggtc
ggcattctcgggatgcacaagatcgagcagcggccggtcgtcgtcgacggcgagatcgtc
atccgcccgatgatgtacctcgccctctcctacgaccaccgtatcgtcgacggcagcgat
gccgtccgcttcctggtgcgggtcaaggagttgatcgaggatccggaatccctgctgctg
gagggctag

DBGET integrated database retrieval system