KEGG   Sphaerobacter thermophilus: Sthe_2075Help
Entry
Sthe_2075         CDS       T01128                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sti  Sphaerobacter thermophilus
Brite
Enzymes [BR:sti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Sthe_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2306752..2307567
Genome map
AA seq 271 aa AA seqDB search
MRWFDAEEHQPFHFESGAAGALLIHGFMGTPAEMRPLGHALAEAGISAHGVLLPGFGPDI
ERLEAMRARDWIQAAASAWEEVRKKHSPASLIGFSMGGAVALHLAAENPPDRLVLLAPLW
RLLSGDWRVRLLPLARYVMRPLRPFEAADFQNPEVRTFFAEAMPGVDLDDPAVQHALRNE
VHLSPVTLDELRRVASGAGRAAERVTVPTLVIQGTDDRTVTPADTRRLAARLNGSTALRE
VPAGHQIVRPEEKAWPTVRDLVVRFTLGGAP
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
gtgcgctggttcgacgctgaggaacatcagccgttccatttcgagtcgggcgcggctggg
gcgctgctgatccacggcttcatgggcaccccggcggagatgcgcccactcgggcacgcc
ctggctgaggccggcatctccgcgcacggtgtgctcctgcccggcttcggtcccgacatc
gagcggttggaggcgatgcgcgcccgcgactggatccaggccgcggccagcgcctgggag
gaggttcgcaagaagcacagcccggcgtcgctgatcggcttctcgatgggcggtgccgtc
gccctccacctcgccgcggagaatccgcccgaccggctggtgctcctcgcgccgctgtgg
cggctcctctccggagactggcgcgtacgcctgcttccgctggcccggtacgtcatgcgg
ccgctgcgccccttcgaggccgccgacttccagaacccggaggtgcgcacgttcttcgct
gaagccatgccgggcgttgacctggacgaccccgcggtgcagcacgccctgcgcaacgag
gttcacctctcgccggtgaccctcgatgagctgcgccgggtcgccagcggagccggacgc
gccgccgagcgcgtcaccgtacccacgctggtgatccagggcaccgatgaccgcacggtc
accccggccgacacccggcggctcgcggcacgcctgaacggcagcaccgcgttgcgggag
gtcccggccggccaccagatcgtgcggccggaggaaaaggcgtggcccaccgtccgcgac
ctcgtcgtccgcttcacgctcggaggtgcgccgtga

DBGET integrated database retrieval system