KEGG   Sphaerobacter thermophilus: Sthe_2327Help
Entry
Sthe_2327         CDS       T01128                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00860  Porphyrin and chlorophyll metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sthe_2327
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sthe_2327
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Sthe_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 FAD_binding_2 HI0933_like Lycopene_cycl Thi4 FAD_oxidored Trp_halogenase GIDA AlaDh_PNT_C Pyr_redox MCRA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACZ39748
JGI: Sthe_2327
UniProt: D1C7A2
Position
1:2589165..2590610
Genome map
AA seq 481 aa AA seqDB search
MAAGRVAIIGGGIAGLAAAYRLRQADTGLALTLVEADTRLGGKIRTERMEGLVIEAGPDS
FLASKPAAAALCEVLGLGDRIVSTTRESGGTYILHRGRLEPLPEGITMLVPTKVRPLLRS
RLLSTRGKLRLATEYFRRPRLDDADESVASFVRRRFGDEVFDHMAQPLLSGIYAGDAEQL
SLLATFPRLRETELRYGSLIRGMLAQRRAAPPPPPAGGQPRGAFLSLRDGLGELIDALVA
SLDGIDWRVGVAAVAVEPVNGGWIVHLADGSAVAADAVLLATPAWATADLVAGIDEELAE
LLRGIPYVSTATISLAYRREDVGQVGVGRGFVIPRIEGRELTAVTWASSKFPHRAPEDLV
LLRAFVGSAGREEAVDLPDDQLLDLVRRELREILGLDATPVLTYIHRWYRALPQYVLGHL
ERVEAIDRRLEQHPGLLLLGAAYRGVGIPDCIVSGERAAARALAYLAGAAEPSRQPQERA
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggtcgcgtcgcgatcatcggcggcggcatcgcagggctggccgcggcctac
cggctgcggcaggccgacaccgggctggccctgacgctggtcgaggccgatacccgcctg
ggcggcaagatccgcaccgagcggatggagggcctggtgatcgaggccggacccgactcc
ttcctcgccagcaagccggccgccgccgccctctgcgaggtgctgggcctcggcgatcgc
atcgtcagcaccacccgggagagcggtggcacctacatcctccaccgcggccggctcgag
ccgctgccggaggggatcactatgctggtgccgaccaaggtccggcccctcctccgctcg
cgcctcctctcgacgcgcggcaagctgcgcctggcgaccgagtacttccgccggccgcgg
ctcgacgacgcggatgagtcggtcgccagcttcgtccgtcgccgcttcggtgatgaggtc
ttcgaccacatggcccaaccgcttctctccggcatctacgccggggatgccgagcagttg
agcctgctcgcgaccttcccgcgcctgcgcgagaccgaactgcgctacggcagcctgatc
cgcgggatgctggcgcagcggcgtgcggccccgccgcctccgcccgctggtggccagccc
cgcggcgcgttcctctcgctccgcgacgggctgggcgagttgatcgacgcgctggtcgcc
tccctcgatgggatcgattggcgggtcggcgtggcggctgtagccgtggagccggtcaac
ggcggctggatcgtccacctggccgacggctcggccgtcgcggccgacgccgtcctgctg
gcaactccggcctgggcgaccgccgacctggtcgccgggatcgacgaggagctcgccgag
ctgctgcgcgggatcccctatgtctccaccgcgaccatctcgctcgcctaccgccgggag
gacgtgggacaggtcggggtcggccgcggcttcgtcatcccgcgcatcgaggggcgggag
ttgacggccgtcacctgggcgtcgagcaagttcccgcaccgcgcgccggaggaccttgtc
ctgctacgcgccttcgtcggcagcgccgggcgcgaggaggcggtcgatctgccggacgac
cagttgctggatctggtgcggcgggaactgcgcgagatcctgggactggacgcgaccccg
gtgctgacgtacatccaccgctggtaccgcgccctgccgcagtacgtcctcggccatctg
gagcgggtggaagccatcgaccggcggctagagcagcatcccggcctcctgctcctcggc
gccgcgtaccgcggtgtcggcatccccgactgcatcgtctccggcgaacgcgccgccgcc
cgggcgctggcgtacctggccggcgcggcggagccgtcacgccaaccgcaagagcgggcc
gggtaa

DBGET integrated database retrieval system