KEGG   Sphaerobacter thermophilus: Sthe_2327Help
Entry
Sthe_2327         CDS       T01128                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sti  Sphaerobacter thermophilus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sthe_2327
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Sthe_2327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2589165..2590610
Genome map
AA seq 481 aa AA seqDB search
MAAGRVAIIGGGIAGLAAAYRLRQADTGLALTLVEADTRLGGKIRTERMEGLVIEAGPDS
FLASKPAAAALCEVLGLGDRIVSTTRESGGTYILHRGRLEPLPEGITMLVPTKVRPLLRS
RLLSTRGKLRLATEYFRRPRLDDADESVASFVRRRFGDEVFDHMAQPLLSGIYAGDAEQL
SLLATFPRLRETELRYGSLIRGMLAQRRAAPPPPPAGGQPRGAFLSLRDGLGELIDALVA
SLDGIDWRVGVAAVAVEPVNGGWIVHLADGSAVAADAVLLATPAWATADLVAGIDEELAE
LLRGIPYVSTATISLAYRREDVGQVGVGRGFVIPRIEGRELTAVTWASSKFPHRAPEDLV
LLRAFVGSAGREEAVDLPDDQLLDLVRRELREILGLDATPVLTYIHRWYRALPQYVLGHL
ERVEAIDRRLEQHPGLLLLGAAYRGVGIPDCIVSGERAAARALAYLAGAAEPSRQPQERA
G
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgggtcgcgtcgcgatcatcggcggcggcatcgcagggctggccgcggcctac
cggctgcggcaggccgacaccgggctggccctgacgctggtcgaggccgatacccgcctg
ggcggcaagatccgcaccgagcggatggagggcctggtgatcgaggccggacccgactcc
ttcctcgccagcaagccggccgccgccgccctctgcgaggtgctgggcctcggcgatcgc
atcgtcagcaccacccgggagagcggtggcacctacatcctccaccgcggccggctcgag
ccgctgccggaggggatcactatgctggtgccgaccaaggtccggcccctcctccgctcg
cgcctcctctcgacgcgcggcaagctgcgcctggcgaccgagtacttccgccggccgcgg
ctcgacgacgcggatgagtcggtcgccagcttcgtccgtcgccgcttcggtgatgaggtc
ttcgaccacatggcccaaccgcttctctccggcatctacgccggggatgccgagcagttg
agcctgctcgcgaccttcccgcgcctgcgcgagaccgaactgcgctacggcagcctgatc
cgcgggatgctggcgcagcggcgtgcggccccgccgcctccgcccgctggtggccagccc
cgcggcgcgttcctctcgctccgcgacgggctgggcgagttgatcgacgcgctggtcgcc
tccctcgatgggatcgattggcgggtcggcgtggcggctgtagccgtggagccggtcaac
ggcggctggatcgtccacctggccgacggctcggccgtcgcggccgacgccgtcctgctg
gcaactccggcctgggcgaccgccgacctggtcgccgggatcgacgaggagctcgccgag
ctgctgcgcgggatcccctatgtctccaccgcgaccatctcgctcgcctaccgccgggag
gacgtgggacaggtcggggtcggccgcggcttcgtcatcccgcgcatcgaggggcgggag
ttgacggccgtcacctgggcgtcgagcaagttcccgcaccgcgcgccggaggaccttgtc
ctgctacgcgccttcgtcggcagcgccgggcgcgaggaggcggtcgatctgccggacgac
cagttgctggatctggtgcggcgggaactgcgcgagatcctgggactggacgcgaccccg
gtgctgacgtacatccaccgctggtaccgcgccctgccgcagtacgtcctcggccatctg
gagcgggtggaagccatcgaccggcggctagagcagcatcccggcctcctgctcctcggc
gccgcgtaccgcggtgtcggcatccccgactgcatcgtctccggcgaacgcgccgccgcc
cgggcgctggcgtacctggccggcgcggcggagccgtcacgccaaccgcaagagcgggcc
gggtaa

DBGET integrated database retrieval system