KEGG   Sphaerobacter thermophilus: Sthe_2381Help
Entry
Sthe_2381         CDS       T01128                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00010  Glycolysis / Gluconeogenesis
sti00620  Pyruvate metabolism
sti00640  Propanoate metabolism
sti00680  Methane metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_2381
   00620 Pyruvate metabolism
    Sthe_2381
   00640 Propanoate metabolism
    Sthe_2381
  Energy metabolism
   00680 Methane metabolism
    Sthe_2381
Enzymes [BR:sti01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Sthe_2381
Lipid biosynthesis proteins [BR:sti01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Sthe_2381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N CheR_N
Motif
Other DBs
NCBI-ProteinID: ACZ39798
JGI: Sthe_2381
UniProt: D1C7F2
Position
1:2648513..2650486
Genome map
AA seq 657 aa AA seqDB search
MAGDLHLDSAAHEDAIVWEPSPADLERSRLLRFIREHGLSDYEALLARAVEDPAWYWDAV
VRHLELEWYTPYDQVLDLSRGLPWPRWFVNGRYNYVHDAVDKRATGPDRDRIAVVWEGDG
GAVRRLTFGELAAETNRLAHALRALGIGKGDRVGIFLPMMPETAIATLACSKIGAVFIPI
FSGYGAEAAATRLTDCDARLLITADAFYRRGSVVPLKATADAAADRSPTVERLLVYRHVG
ADVPWNPERDVWWHEAVADQPDHYDTERTAGDDPYMIIYTSGTTGRPKGAVHTHAGFPIK
AAHDLAFCFDLQPDDTLFWITDLGWMMGPWAIEGTLMLGATLLLYEGTPDYPEPDRLWQV
VERHGATVLGVSPTAVRALMSRGDEWATRHPMPTLRAFGSTGEPWNPGPWRWLFTVPGQS
RRPILNYSGGTEISGGIVGCVTIKPQKPCAFTGPVPGMAADVVDADGRSVRGEVGELVIR
GPWVGMTNGFWRDPDRYLATYWSRWPDVWVHGDWAEVDADGFWYILGRSDDTIKVAGKRV
GPAEVESAAVAHPAVQEAAAIGVPDPVKGEAVVIFAILRPGYTPGDDLREEIRDVVTQRL
GRPLRPADIRFVSDLPRTRNAKIMRRVIRAKYTGQENLGDLSALENPAAVEEIGRVG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgatctccacctcgactccgcggcacacgaggacgctatcgtctgggagccg
tcgcccgccgacctggagcgcagccgcctactgcgcttcatccgtgagcacgggctgtcc
gactacgaggcactgctggcgcgggctgtggaggaccctgcctggtactgggatgcggtg
gtgcggcacctcgagttggagtggtacacgccctacgatcaggtgctcgatctgagccgc
gggctcccctggccgcgctggttcgtcaacggccggtacaactacgtgcatgacgcggtc
gacaagcgtgcgaccggaccggatcgcgaccgtatcgccgtcgtctgggagggggacggc
ggggcggtccggcgcctcaccttcggcgaactcgcggccgagacgaaccggctggcgcac
gccctgcgtgcgctgggcatcggcaagggggaccgggtcgggatcttcctgccaatgatg
cccgagacggcgatcgctacgctggcctgcagcaagatcggcgcggtcttcatcccgatc
ttctccggctacggtgccgaggcggccgcgacacgcctgaccgactgcgatgcccgcctg
ctcatcaccgccgatgcgttctaccgccgcgggagcgtcgtcccgctgaaggccacggcc
gatgccgcggctgaccggtccccgaccgtcgagcgcctgctggtctaccgccacgtcggg
gcggatgtcccctggaacccggagcgtgacgtctggtggcatgaggcggtcgcagaccag
ccggaccactacgacaccgagcggacagcgggcgacgacccgtacatgatcatctacacc
tcgggcacgaccggtcgaccgaagggcgcggtgcacacccacgccgggttcccgatcaag
gcggcgcacgacctcgccttctgcttcgatctccaacccgacgacacgctgttctggatc
accgacctcggctggatgatggggccgtgggccatcgaggggacgctaatgctgggcgcc
acgctcctcctctacgaaggcacgcccgactaccccgagccggaccgcctgtggcaggtc
gtcgagcggcacggcgcgaccgtgctcggcgtctcgccgaccgcggtgcgggcgctgatg
agccggggcgacgagtgggccacgcggcacccgatgccgacgctccgcgccttcggctcc
accggcgagccatggaaccccggcccctggcgctggctgttcaccgtgccggggcagagc
cgccggccgatcctgaactattccggcgggaccgagatctccggcggcatcgtcggctgc
gtgacgatcaagccgcagaagccttgcgccttcaccggtccggttccgggcatggcggcc
gacgtggtcgacgccgatgggcggtcggtgcgcggcgaggtgggggagctggtcatccgc
ggcccgtgggtcgggatgaccaacggcttctggcgcgatccggaccgctacctcgcgacc
tactggtcacgctggcccgacgtctgggtccacggcgactgggccgaggtggacgccgac
ggcttctggtacatcctcggccgctccgacgatacgatcaaggtagcaggcaagcgggtc
ggaccggcggaagtcgagtcggccgcggtggcgcatccggcggtgcaggaggcggccgct
atcggcgtgcccgacccggtcaagggcgaggcggtcgtcatcttcgccatcctccgtccc
ggctataccccgggagacgacctgcgggaggagatccgcgacgtagtgacccagcgcctg
ggtcgcccgctgcgcccggccgacatccgcttcgtcagcgacttgccgcgcacgcgcaac
gccaagatcatgcgccgcgtgatccgcgccaagtacaccggccaggagaacctgggcgac
ctctcggcgttggagaacccggccgcggtcgaggagatcggccgggtggggtga

DBGET integrated database retrieval system