KEGG   Sphaerobacter thermophilus: Sthe_2576Help
Entry
Sthe_2576         CDS       T01128                                 

Definition
(RefSeq) Enoyl-CoA hydratase/isomerase
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sti  Sphaerobacter thermophilus
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sthe_2576
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sthe_2576
   00650 Butanoate metabolism
    Sthe_2576
  Lipid metabolism
   00071 Fatty acid degradation
    Sthe_2576
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sthe_2576
   00310 Lysine degradation
    Sthe_2576
   00360 Phenylalanine metabolism
    Sthe_2576
   00380 Tryptophan metabolism
    Sthe_2576
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sthe_2576
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sthe_2576
   00281 Geraniol degradation
    Sthe_2576
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sthe_2576
   00627 Aminobenzoate degradation
    Sthe_2576
   00930 Caprolactam degradation
    Sthe_2576
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sthe_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:127784..128566
Genome map
AA seq 260 aa AA seqDB search
MGVTYETLIVEKLDGRVGLIRLNRPERLNALNQALMRELVQAVAAFDQDDEVGVIVLTGN
EAAFAAGADVTEMDGAGVADMLSGYCFDEWEQLRRTRKPMIAAVSGWALGGGCELAMLCD
MIVASETARFGQPEINLGIMPGAGGTQRLTRQVGKYLAMEMVLAGRQLTAAEAERFGLVN
RVVPVEVYLDAAIELARTVAAKAPLAVQLAKEAILRGQDVPLEAGLAHERHNFYLLFGTA
DKQEGIRAFLEKRRAEWQGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgacctacgagaccctgatcgtcgagaagctggatggccgggtgggcctgatc
cggctcaaccgcccggagcggctcaacgcgctcaaccaggcgctgatgcgcgagctggtg
caggcggttgcggcgttcgaccaggacgacgaggtcggcgtcatcgtgctcaccggtaat
gaggcggcctttgccgccggggccgacgtgaccgagatggacggcgcgggcgtggccgac
atgctgagcggctactgcttcgacgagtgggaacagctccgccggacccgcaagccgatg
atcgcggctgtatccggctgggcgctaggtggtggctgcgagctggcgatgctgtgcgac
atgatcgtcgcctcggagacggcccggttcggccagccggagatcaacctcgggatcatg
ccgggcgcgggcggaacccagcggttgacgcgccaggtcggcaagtacctggcgatggag
atggtgctggccgggcggcagctcaccgctgccgaggcggaacgcttcgggctggtcaac
cgggtggtgccggtcgaggtctacctggacgccgcgatcgagctggcccgcacagtggcg
gcaaaggcgccgctggcggtacagctcgccaaggaggcgatcctccgtgggcaggacgtg
ccgctggaggcggggctggcccacgagcgccacaacttctacctgctcttcggcaccgcg
gacaagcaggaggggattcgggccttcttggagaagcgtcgcgccgaatggcagggacga
tag

DBGET integrated database retrieval system