KEGG   Sphaerobacter thermophilus: Sthe_2576Help
Entry
Sthe_2576         CDS       T01128                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00071  Fatty acid degradation
sti00280  Valine, leucine and isoleucine degradation
sti00281  Geraniol degradation
sti00310  Lysine degradation
sti00360  Phenylalanine metabolism
sti00362  Benzoate degradation
sti00380  Tryptophan metabolism
sti00410  beta-Alanine metabolism
sti00627  Aminobenzoate degradation
sti00640  Propanoate metabolism
sti00650  Butanoate metabolism
sti00903  Limonene and pinene degradation
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sthe_2576
   00650 Butanoate metabolism
    Sthe_2576
  Lipid metabolism
   00071 Fatty acid degradation
    Sthe_2576
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sthe_2576
   00310 Lysine degradation
    Sthe_2576
   00360 Phenylalanine metabolism
    Sthe_2576
   00380 Tryptophan metabolism
    Sthe_2576
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sthe_2576
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sthe_2576
   00281 Geraniol degradation
    Sthe_2576
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sthe_2576
   00627 Aminobenzoate degradation
    Sthe_2576
   00930 Caprolactam degradation
    Sthe_2576
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sthe_2576
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACZ39991
JGI: Sthe_2576
UniProt: D1C848
Position
2:127784..128566
Genome map
AA seq 260 aa AA seqDB search
MGVTYETLIVEKLDGRVGLIRLNRPERLNALNQALMRELVQAVAAFDQDDEVGVIVLTGN
EAAFAAGADVTEMDGAGVADMLSGYCFDEWEQLRRTRKPMIAAVSGWALGGGCELAMLCD
MIVASETARFGQPEINLGIMPGAGGTQRLTRQVGKYLAMEMVLAGRQLTAAEAERFGLVN
RVVPVEVYLDAAIELARTVAAKAPLAVQLAKEAILRGQDVPLEAGLAHERHNFYLLFGTA
DKQEGIRAFLEKRRAEWQGR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgacctacgagaccctgatcgtcgagaagctggatggccgggtgggcctgatc
cggctcaaccgcccggagcggctcaacgcgctcaaccaggcgctgatgcgcgagctggtg
caggcggttgcggcgttcgaccaggacgacgaggtcggcgtcatcgtgctcaccggtaat
gaggcggcctttgccgccggggccgacgtgaccgagatggacggcgcgggcgtggccgac
atgctgagcggctactgcttcgacgagtgggaacagctccgccggacccgcaagccgatg
atcgcggctgtatccggctgggcgctaggtggtggctgcgagctggcgatgctgtgcgac
atgatcgtcgcctcggagacggcccggttcggccagccggagatcaacctcgggatcatg
ccgggcgcgggcggaacccagcggttgacgcgccaggtcggcaagtacctggcgatggag
atggtgctggccgggcggcagctcaccgctgccgaggcggaacgcttcgggctggtcaac
cgggtggtgccggtcgaggtctacctggacgccgcgatcgagctggcccgcacagtggcg
gcaaaggcgccgctggcggtacagctcgccaaggaggcgatcctccgtgggcaggacgtg
ccgctggaggcggggctggcccacgagcgccacaacttctacctgctcttcggcaccgcg
gacaagcaggaggggattcgggccttcttggagaagcgtcgcgccgaatggcagggacga
tag

DBGET integrated database retrieval system