KEGG   Sphaerobacter thermophilus: Sthe_2686Help
Entry
Sthe_2686         CDS       T01128                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sthe_2686
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_2686
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sthe_2686
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sthe_2686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:260768..261982
Genome map
AA seq 404 aa AA seqDB search
MGIPTGATVVYDDGTEETFEDVSLAEARADEGRVEYRYAYAADLLPGEPAGETGMWRYRA
LLPLEEGPIHYPLPVGGTPLVAAPGLRNRLQMPHLWVKDETRGPTGSNKDRATAMVLEHA
MRAGAQTVSCASTGNVAVSLAVGAAAAGLRAVIFVPEQVAESKLALMRLAGATVLKVREG
YDAAMRFSRRAAREFGWFDRNTGYNPATLEAKKTVAFEIWEQLGRRVPDVVVSPIGDGVT
LSALAKGFRELVACGVTTGVPRIIGVQAEGCQPVKLAWERGGQVEPVEPKTIADGIAVGQ
PLSGAAVLRDVRDSGGAFVAVSDDAMVRAIGTLAASAGILAEPAGAAAMAGLEVALEAGL
VSRDERVVVLATGTVLKNPIFPELPGAVHTVHADLDELRRALGV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgggcattccgaccggcgcgacggtcgtgtacgacgacggcaccgaagagacgttcgag
gacgtgagcctcgccgaggcgcgagccgatgaggggcgggtggagtaccggtacgcctac
gccgcggacttgctgccgggtgagccggcaggagagaccgggatgtggcgctaccgtgcg
ctcttgccgctggaggaggggccgatccactacccgctgccggtcggggggaccccgctc
gtggcggctcccgggctccggaaccggctgcagatgccacacctctgggtgaaggacgaa
acgcgtgggccgaccggctcgaacaaggaccgcgccacagcgatggtgctggagcacgct
atgcgcgccggggcgcagacggtgagctgcgcctcgaccggcaacgtggcggtgtcgctg
gcagttggggcggccgcggccgggctgcgggcggtcatcttcgtgccggagcaggtcgcg
gagtcgaagctggcgctcatgcggctggccggggcgacggtgctgaaggtccgcgagggc
tatgacgcggcgatgcgcttctcgcgtcgggcggctcgcgagttcggctggttcgaccgc
aacacgggctacaacccggccacgctggaagcgaagaagaccgttgccttcgagatctgg
gagcagttgggccgcagggtgccggacgtggtggtgtcgccgatcggcgacggggtgacc
ctcagcgcgctggccaagggcttccgcgagctggtcgcctgcggcgtcaccacaggcgtg
ccccggatcatcggcgtccaggccgaggggtgccagccggtgaaactggcctgggagcgg
ggtggccaggtcgagccggtggagcccaagacgatcgccgacggaatcgcggtgggccag
ccgctgagcggggcggccgtgctgcgggatgtgcgtgattcgggcggagctttcgtcgcg
gtgagcgatgacgcgatggtgcgcgctattggcacgctggcggcgtcggcgggcatcctg
gccgagccggccggcgcggccgccatggccgggctggaagtggcgctggaggccgggctg
gtgagccgcgatgagcgggtcgtggtgctcgcgaccggcaccgtgctgaagaatccgatc
tttccggagttgcccggcgcggtacacaccgtgcacgccgatctggacgagttgcggcgg
gcgctcggagtgtag

DBGET integrated database retrieval system