KEGG   Sphaerobacter thermophilus: Sthe_2906Help
Entry
Sthe_2906         CDS       T01128                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00620  Pyruvate metabolism
sti00630  Glyoxylate and dicarboxylate metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sthe_2906
   00630 Glyoxylate and dicarboxylate metabolism
    Sthe_2906
Enzymes [BR:sti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sthe_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase
Motif
Other DBs
NCBI-ProteinID: ACZ40314
JGI: Sthe_2906
UniProt: D1C921
Position
2:complement(535063..536637)
Genome map
AA seq 524 aa AA seqDB search
MMANGIRVVGPMTSEYAEILTPEALAFVERLHREFNPRREELLRLRQERQAKILAGGTLD
FLPETRDVREGEWSVAPAPADLNDRRVEITGPVDRKMIINALNSGAKVFMADFEDANSPT
WANIVEGQRNLRDAVRRTISFENPDGRRYELRDETATLVVRPRGWHLVERHVEVDGQPVS
ASLFDFGLYFFHNAAELIARGSGPYFYLPKLQGHLEARLWNDVFRSAQDALVIPQGTIRA
TVLVETIWAAFEMDEILYELREHASGLNAGRWDYIFSVIKTFRDRPDAILPDRAQVTMTV
PFMRTYTELLVRTCHRRGAHAIGGMAAFIPSRRDPKVNEVALAKVREDKEREAGDGFDGT
WVAHPDLVPVAQAEFDRVLGDRPHQKDRLREDVQVTAADLLAFQVPGGTITEEGIRNNVS
VALQYINSWLQGVGAAAIFNLMEDAATAEISRAQLWQWLHHGARTAGGGQFTAERYERIR
DEELAKLGGRDTQRYADAAEILDSLVLSESFTDFLTVPAYALLE
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgaacgggatccgtgtcgtggggccgatgacgagcgagtacgcggagatcctc
acgccggaggcactggcctttgtcgagcggctgcatagggagttcaacccgcggcgggag
gagttgctgcgcctgcggcaggagcgacaggcgaagatcctggccgggggcacgctcgat
ttcctgccggagacgcgcgacgtgcgcgagggggagtggtccgtcgcccctgcgccggcc
gacctgaacgaccggcgggtggagattaccgggccggtcgaccgcaagatgatcatcaac
gcgctcaactccggcgccaaggtcttcatggccgacttcgaggacgcaaactcgccgacc
tgggccaacatcgtggaggggcagcgcaacctgcgggacgcggtgcggcgcacgatttcg
ttcgaaaaccccgacgggcggcgctatgagctgcgggacgagacggcgacgctggtggtg
cggccgcgcggctggcacctggtggagcggcatgtcgaggtggacggacagccggtgtcg
gccagcctgttcgatttcggcctctacttcttccacaacgcagccgaattgatcgcgcga
gggagcgggccgtacttctacctgccgaagctgcagggtcatctcgaggcgcgcctctgg
aacgacgtctttcgctcggcgcaggacgcactcgttattccgcagggcacgatccgggcg
acggtgctggtcgagacgatctgggccgcgttcgagatggacgagatcctctacgaactc
cgcgagcacgcatctgggttgaacgcggggcggtgggactacatcttcagcgtgatcaag
acgttccgcgaccgacccgacgcgatcctccccgatcgggcgcaggtgacgatgacggtg
ccgttcatgcgtacctacaccgagttgctggtgcggacctgccaccgccgcggcgcccac
gccattggcggcatggcggcgttcatcccgagccggcgcgacccgaaggtgaacgaggtg
gcgctggccaaggtgcgggaggacaaggagcgcgaggcgggcgacgggtttgacggcacc
tgggtggcccaccccgacctggtgccggtggcgcaggcggagttcgaccgggttctcggc
gatcggccccaccagaaggaccggctgcgagaggatgtgcaggtgacggcagcggacctg
ctcgcattccaggtgccgggtggcacgatcaccgaggagggcatccgcaacaatgtgagc
gtggcgctacagtacatcaactcctggctgcagggcgttggcgccgcggcgatcttcaac
ctgatggaggacgcagccacggccgagatctcgcgagcgcagctctggcagtggctccac
cacggtgcccgcactgccggtggcgggcagttcaccgccgaacgctacgagcgtatccgg
gatgaggaactggcgaagcttggcgggcgcgacacgcaacgctatgccgacgcggctgag
atcctggattcgttggtcctgagcgagtcgttcaccgacttcctgactgtcccggcctac
gcgctgctggagtga

DBGET integrated database retrieval system