KEGG   Sphaerobacter thermophilus: Sthe_2950Help
Entry
Sthe_2950         CDS       T01128                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sthe_2950
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_2950
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sthe_2950
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sthe_2950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:593609..594979
Genome map
AA seq 456 aa AA seqDB search
MASNGDSQTKYLLSEAEMPTAWYNLQADLPNPAPPLHPGTGQPIGPADLAPLFPMALIEQ
EVSTERWIEIPEEVQAVYRLWRPTPLYRARRLEKALGTPARIFYKYEGTSPAGSHKPNTA
VAQAYYNKQEGIKRLTTETGAGQWGSALAMACAFFGLELKVYMVKVSYEQKPYRRALMEA
WGATCVPSPSTDTESGRRILAADPNSRGSLGIAISEAVEDAASRDDTHYSLGSVLNHVLL
HQTVIGQEAQKQLAMADAEPDIIIGCAGGGSNFAGLSFPFVREKLLGKEIRIVAVEPAAC
PTLTRGVYAYDFGDTGQMTPLLKMHTLGHSFMPAAIHAGGLRYHGMAPLVSLLYEQGLIE
AVALPQTKVFEAAVQFARTEGLVPAPESAHAVRAAIDEALRCKETGEAKTILFGLSGHGN
FDMAAYEAYFAGQLMDYAHPQEEIEAALAGLPAVGN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcgagcaacggcgatagccagacaaagtacctgctctcggaagcggagatgccgact
gcctggtacaacctgcaggcggacctgccgaacccggcgccgccgctgcacccgggcacg
ggccagccgatcgggccggctgatctggcgccgctcttcccgatggcgctgatcgagcag
gaggtcagcaccgagcgctggatcgagatcccggaggaggtccaggcggtttatcggctc
tggcggccgaccccgctctaccgggcgcgccggctggagaaggcgctcgggacccccgcg
cggatcttctacaagtacgaaggcacgagcccggccgggagtcacaagcccaacaccgcc
gtggcccaggcgtactacaacaagcaagagggcatcaagcggctgaccacggagaccggg
gccgggcagtggggcagcgcgctggcgatggcctgcgccttcttcggccttgagctgaag
gtctacatggtcaaggtcagctacgagcagaagccctaccgccgggcgctgatggaagcc
tggggcgccacctgtgtccccagcccgagcaccgacaccgagtcgggccggcgcatcctc
gcggccgatcccaactcgcgggggagcctggggatcgcgatcagcgaggcggtggaggac
gccgcttcccgggatgacacccactactcgctcggcagcgtgctcaaccacgtgctgctg
caccagacggtgatcggccaggaggcgcagaagcagctcgccatggccgacgccgagccg
gacatcatcatcggctgcgccggtggcggctcgaacttcgccgggctgagcttccccttc
gtgcgcgagaagctgctggggaaggagatccggatcgtggcggtcgagccggccgcctgc
ccgacgctgacccgcggcgtctacgcctacgacttcggcgacaccgggcagatgacgccc
ctgctgaagatgcacacgctcggccacagcttcatgccggcagcgatccacgccggtggg
ctccgctaccacggcatggcgccgttggtgagcctgctctacgagcaggggttgatcgag
gcggtggccctgccgcagacgaaggtgttcgaggcggcggtgcagttcgcgcggaccgag
gggctggtcccggcgccggagtcggcccacgcggtgcgtgcggcgatcgacgaggcgctg
cgctgcaaggagaccggcgaggccaagacgatcctgttcggcctgagcggccacgggaac
ttcgacatggcggcctacgaggcctatttcgcgggtcaactgatggactacgcccacccc
caggaggagatcgaagccgcgctggccggtctgcccgcggtggggaactag

DBGET integrated database retrieval system