KEGG   Sphaerobacter thermophilus: Sthe_3121Help
Entry
Sthe_3121         CDS       T01128                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sthe_3121
Enzymes [BR:sti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sthe_3121
Exosome [BR:sti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sthe_3121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(776757..778253)
Genome map
AA seq 498 aa AA seqDB search
MAQAVLALDQGTTSSRAILFGHDGRPILARNQEFPQIYPQPGWVEHSPEDIWNSQVAVAK
HVLESGRVALEDVVAIGITNQRETTLIWERDTGNPVHNAIVWQDRRTAAICDQLKAAGWE
EQIRDKTGLVIDPYFSGTKVKWLLDNVYDLRARAERGELAFGTVDTYLIWKLTGGKVHVT
DYSNASRTLLFNIHTLDWDDDILKEFGIPRALLPEVRPSSAVYGETDPSIFGRAIPIAGD
AGDQQAATFGQACYQVGMAKQTYGTGSFMLMNIGDKPQPSKSGLLTTIAWGVDDKVIYAL
EGSIFITGAAVQWLRDSLQIISNAAESEVLATQIGSNNGVYFVPAFVGLGAPYWDAYARG
AIVGLTRGAGRAEIARAALESVAYQTRDVLEAMQTDTGIEFKELRVDGGMVANDFLMQFQ
ADIIGKAVERPEVAETTALGAAYLAGLAVGFWKDEQDIAQNWQLNRRFEPQMSEEERERL
YTGWKRAVERARDWEVRE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
gtggcacaggcggtattggcactggaccaggggacaaccagctcacgcgctattctgttc
ggccatgacggccgcccgatcctcgcgcggaaccaggaatttcctcagatctacccacag
ccaggttgggtcgagcatagcccggaggacatctggaactcgcaggtcgccgtcgccaag
catgtgctggagagcggtcgtgtggcgctcgaggacgtggtcgccatcggcatcaccaac
cagcgcgaaacgacgctgatctgggagcgtgacaccggcaacccggtgcacaacgccatc
gtctggcaggaccggcgcaccgctgccatctgcgatcagctcaaggctgccggctgggag
gagcagatccgcgacaagaccggactggtcatcgacccctacttctccggtaccaaggtc
aagtggctcctcgacaacgtctacgacctccgcgcgcgcgccgagcgcggggaactcgcc
ttcggtacggtggacacctacctgatctggaagctgaccggcgggaaggtccacgtcacc
gattactcgaacgcctcgcgcacgctcctgttcaacatccacacgctcgactgggatgac
gacatcctcaaggagttcggcatcccccgggcgttgctgcccgaggtgcgcccgtcgagc
gccgtctacggcgagaccgatccgagcatcttcggccgcgcgatcccgatcgccggggat
gccggcgaccagcaggccgccaccttcggtcaggcctgctatcaggtcggcatggccaag
cagacctacggcaccggcagcttcatgctgatgaacatcggcgacaagccccagccctcg
aagagcggcctgctcaccaccatcgcctggggtgtcgacgacaaagtcatctacgccctt
gaaggctcgatcttcatcaccggggcggccgtccagtggctgcgcgactcgctccagatc
atcagcaacgcggccgagtcggaggtgctggccacccagatcggctcgaacaacggtgtc
tacttcgtccccgccttcgtcggcctcggcgccccctattgggacgcctacgcccgcggc
gctatcgtcgggctgacccgcggcgcgggccgtgcggagatcgctcgcgccgcgctggag
tcggtcgcctaccagacccgtgacgtgctggaggcgatgcagaccgacaccggcatcgag
ttcaaggaactgcgcgtggacggcggcatggtcgccaacgacttcctgatgcagttccag
gccgacatcatcggcaaggcggtggagcggcccgaggtggcggagacgacggcgctcggc
gcggcctacctcgccggtctggccgtcggcttctggaaggacgagcaggacatcgcccag
aactggcaactcaatcgtcgcttcgagccgcaaatgagcgaggaagagcgcgagcgactc
tacacaggttggaagcgcgccgtcgagcgcgcccgcgactgggaggttcgcgagtag

DBGET integrated database retrieval system