KEGG   Sphaerobacter thermophilus: Sthe_3226Help
Entry
Sthe_3226         CDS       T01128                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00010  Glycolysis / Gluconeogenesis
sti00020  Citrate cycle (TCA cycle)
sti00620  Pyruvate metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
sti01120  Microbial metabolism in diverse environments
sti01130  Biosynthesis of antibiotics
sti01200  Carbon metabolism
Module
sti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_3226
   00020 Citrate cycle (TCA cycle)
    Sthe_3226
   00620 Pyruvate metabolism
    Sthe_3226
Enzymes [BR:sti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sthe_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Biotin_lipoyl Abhydrolase_5 Esterase Thioesterase Ndr Acyl_transf_1 Chlorophyllase2 Chlorophyllase Ser_hydrolase DUF2048 PAF-AH_p_II Esterase_phd PGAP1
Motif
Other DBs
NCBI-ProteinID: ACZ40626
JGI: Sthe_3226
UniProt: D1C9Y3
Position
2:898904..900034
Genome map
AA seq 376 aa AA seqDB search
MTTETQVIKLTMPKWGLSMTEGRLVSWLVDEGSTIRPGDEVAEVETEKINGVVEAPAGGI
LRRRVAEPGQVIPVGGMLGIIADEATPDEAIQELIAEFEATFVPPAEAGDTGPVPEQVTV
GDRTIRYLRHGEDGPAVILIHGFGGDLNTWLFNQEALAGGRTVYALDLPGHGGSSKDVGD
GSLDVLAGTVAGFMDALGIERAHLAGHSMGGATAMAVATAHPERVASLTLIASAGLGPEI
NGDFIEGFIAAGSRRQMTPVLTMLFADQSLVTRQFVEDTLRSKRIDGVDQALRTLADRLF
PGGRQATVLAPALAGLDVPVLGIWGREDQILPVDHANALPSHARVEIIEGKGHSVQMEAA
SEVTRLIDRFLAEVDA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggagacccaggtcatcaagctgacgatgcccaagtggggtctatcgatgacc
gaggggcgcctcgtgagctggctggtggacgaggggagcaccatccggccgggagacgag
gtggccgaggtcgaaaccgagaagatcaacggtgtggtcgaggcgccggctgggggcatc
ctgcgccggcgcgtggctgagcccggccaggtgatcccggtcggtggcatgctcggcatc
atcgccgacgaggcgaccccggacgaagcgatccaggaactgatcgccgagttcgaggcc
accttcgtcccacccgccgaagcgggcgataccgggccggtgcccgagcaggtgaccgtc
ggcgaccgcaccatccgctacctacggcacggtgaggacggcccggccgtcatcctgatc
cacggattcggtggcgacctgaacacctggctcttcaatcaggaggcgctggccggaggc
cgcacggtctacgccctcgacctgccggggcacggcgggtcgagcaaggacgtgggtgac
ggatcgctcgacgtgctggcgggcaccgtcgccgggttcatggacgcactcgggatcgag
cgcgcccacctggccggccactcgatgggtggggcgacggcgatggctgtcgccacggcc
catccggagcgcgtcgcctccctgaccctgatcgccagcgccgggctcggtcccgagatc
aacggggacttcatcgagggcttcatcgccgccgggtcgcgccggcagatgacacccgtg
ctcaccatgctctttgcggaccagtcgctcgtcacccgccagttcgtggaggatacgctg
cgttcaaagcggatcgacggcgtggaccaggccctgcgaacgctggccgaccggctcttc
cccggcgggcggcaggcgacggtactggctccggcgctggccggcctcgatgtcccggtg
cttggcatctggggtcgggaggaccagatcctcccggtcgaccacgccaacgcactgccg
tcccacgcccgggtggagatcatcgagggtaagggccactcggtccagatggaggccgcg
agcgaggtcacacggctgattgaccgcttcctcgctgaggtggatgcctga

DBGET integrated database retrieval system