KEGG   Sphaerobacter thermophilus: Sthe_3226Help
Entry
Sthe_3226         CDS       T01128                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_3226
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sthe_3226
   00020 Citrate cycle (TCA cycle)
    Sthe_3226
   00620 Pyruvate metabolism
    Sthe_3226
Enzymes [BR:sti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Sthe_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:898904..900034
Genome map
AA seq 376 aa AA seqDB search
MTTETQVIKLTMPKWGLSMTEGRLVSWLVDEGSTIRPGDEVAEVETEKINGVVEAPAGGI
LRRRVAEPGQVIPVGGMLGIIADEATPDEAIQELIAEFEATFVPPAEAGDTGPVPEQVTV
GDRTIRYLRHGEDGPAVILIHGFGGDLNTWLFNQEALAGGRTVYALDLPGHGGSSKDVGD
GSLDVLAGTVAGFMDALGIERAHLAGHSMGGATAMAVATAHPERVASLTLIASAGLGPEI
NGDFIEGFIAAGSRRQMTPVLTMLFADQSLVTRQFVEDTLRSKRIDGVDQALRTLADRLF
PGGRQATVLAPALAGLDVPVLGIWGREDQILPVDHANALPSHARVEIIEGKGHSVQMEAA
SEVTRLIDRFLAEVDA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaccacggagacccaggtcatcaagctgacgatgcccaagtggggtctatcgatgacc
gaggggcgcctcgtgagctggctggtggacgaggggagcaccatccggccgggagacgag
gtggccgaggtcgaaaccgagaagatcaacggtgtggtcgaggcgccggctgggggcatc
ctgcgccggcgcgtggctgagcccggccaggtgatcccggtcggtggcatgctcggcatc
atcgccgacgaggcgaccccggacgaagcgatccaggaactgatcgccgagttcgaggcc
accttcgtcccacccgccgaagcgggcgataccgggccggtgcccgagcaggtgaccgtc
ggcgaccgcaccatccgctacctacggcacggtgaggacggcccggccgtcatcctgatc
cacggattcggtggcgacctgaacacctggctcttcaatcaggaggcgctggccggaggc
cgcacggtctacgccctcgacctgccggggcacggcgggtcgagcaaggacgtgggtgac
ggatcgctcgacgtgctggcgggcaccgtcgccgggttcatggacgcactcgggatcgag
cgcgcccacctggccggccactcgatgggtggggcgacggcgatggctgtcgccacggcc
catccggagcgcgtcgcctccctgaccctgatcgccagcgccgggctcggtcccgagatc
aacggggacttcatcgagggcttcatcgccgccgggtcgcgccggcagatgacacccgtg
ctcaccatgctctttgcggaccagtcgctcgtcacccgccagttcgtggaggatacgctg
cgttcaaagcggatcgacggcgtggaccaggccctgcgaacgctggccgaccggctcttc
cccggcgggcggcaggcgacggtactggctccggcgctggccggcctcgatgtcccggtg
cttggcatctggggtcgggaggaccagatcctcccggtcgaccacgccaacgcactgccg
tcccacgcccgggtggagatcatcgagggtaagggccactcggtccagatggaggccgcg
agcgaggtcacacggctgattgaccgcttcctcgctgaggtggatgcctga

DBGET integrated database retrieval system