KEGG   Sphaerobacter thermophilus: Sthe_3398Help
Entry
Sthe_3398         CDS       T01128                                 

Definition
Pyridoxal-5'-phosphate-dependent protein beta subunit
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sthe_3398
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sthe_3398
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sthe_3398
Enzymes [BR:sti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sthe_3398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1102356..1103543)
Genome map
AA seq 395 aa AA seqDB search
MRAALSSIMTPNNRDTQEEAGMSDWRMVCEACGHEEPLDTAAWRCPACGGAFGITGPDRL
APAAIDPDAPGLWRYRAILPVPLEAARPLGEGMTPLVPGTLLGRRVLFKLDGLLPTGSFK
DRGAAVLVAHLRRLGRQRIIVDSSGNAAAAMAGYSAAAGLACTVYAPASASPGKLVQSRA
YGATVVPVEGNREAVAAAAQQAAADDPSAFYASHNWHPVFVEGVKTWLLEVWEQLGQQLP
AACFIPTGGGSALIGAWRATTALPGPAPALVAAQPAACAPLVAAVQASTEVTPITPGDTI
AEGTRIGAPARPRQMLAAVRETGGWAEAVPEEEIVAALRELWGQGLYVEPTAAVGAAAFR
QAVRRGHPIPEGEVVVLLTGSGLKAAPDMVAALLG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
gtgagggctgccctctccagtatcatgacccccaacaaccgcgacacccaggaggaggca
gggatgagcgactggcggatggtgtgtgaggcgtgcgggcacgaggagccgttggatacc
gcagcgtggcgctgtccggcctgcggcggagccttcgggatcaccgggccggaccggctc
gccccggcagccatcgaccctgacgcacccggcctctggcgctaccgtgcgatcctgccg
gtgccgctggaggcggctcgcccgctcggcgaggggatgacaccgctggtgccgggcact
ctgctcggccgcagggtcttgttcaagctggacgggctgctgccgaccggctcgttcaag
gaccggggcgcggcagtgctggtcgcccacctgcggcggctcgggcgccagcggatcatc
gtcgactcctcgggcaacgctgccgcggcgatggccggctacagcgccgcggccgggctc
gcctgcaccgtctacgcccccgccagcgcctctcccggcaagctggtccagtcgcgtgcc
tacggcgccaccgtcgtcccggtggagggcaaccgggaggcggtcgccgccgccgcgcaa
caggccgcggcggacgatccgtccgccttctacgccagccacaactggcaccccgtcttc
gtcgagggcgtgaagacgtggttgctggaggtctgggagcagttggggcaacagctcccg
gccgcctgcttcatcccgaccggaggcgggagcgccctgatcggcgcctggcgcgctaca
acggcccttcctggcccggccccggcgctcgtcgccgcccaacccgccgcctgtgctccg
ctcgtcgccgccgtccaggccagcaccgaagtgacgccgatcactccgggcgacaccatc
gccgaggggacgcgcatcggcgccccggcccggccgcgccagatgctcgccgccgtccgc
gagaccggcggctgggccgaggccgtgccggaagaggagatcgtcgcggcgctgcgcgaa
ctctggggccaggggctctacgtcgagccgaccgcggccgtcggcgcagccgccttccgc
caggcggtccggcgcgggcacccgatcccggaaggagaggtcgtcgtacttctgaccggc
tccggcctgaaggcggcgccagacatggtggccgcgctccttggatga

DBGET integrated database retrieval system