KEGG   Sphaerobacter thermophilus: Sthe_3425Help
Entry
Sthe_3425         CDS       T01128                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sti  Sphaerobacter thermophilus
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sthe_3425
  Energy metabolism
   00680 Methane metabolism
    Sthe_3425
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sthe_3425
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Sthe_3425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1133964..1135169)
Genome map
AA seq 401 aa AA seqDB search
MKAVVYKGPNQVAVEEVPDPKIEAPTDVLVRITSSAICGSDLHMYEGRTAASPGIVFGHE
NMGVVEEVGSGVASIKKGDRVVMPFNIACGFCFNCVRGYTGFCLTANPGFAGSAYGYVAM
GPYPGGQAELLRVPFADFNCLKLPGQPGDQWEDDFMMLADIFPTGYHGTELADVRPGSTV
AVFGAGPVGLMAAYSALLRGASEVYVVDRVPERLQKAKEIGAIPIDFSKGDPVEQIFDMR
RQNAGVTGAMRPGEESMIGVMCGIDAVGYQAFSHGTGSQEQPNQVLEDLIRVVNPTGRIG
IPGLYVPTDPGGVDQAAKQGQLLLSFGKMFEKGIRLGTGQTNVKQYNVFLRDLIISGRAK
PSFVVSHRVPLEKAPEAYEKFDKRVEGYTKVVLKPQQTAAD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgttgtctacaagggcccgaatcaggtcgccgtcgaggaagtccccgacccc
aagatcgaagcccccaccgatgtactcgtccgcatcacgtccagcgccatctgcggcagc
gatctccatatgtatgaggggcgcaccgccgcctcaccgggcatcgtcttcggccacgag
aacatgggcgtcgtggaggaggtcggcagcggcgtcgcgtcgatcaagaagggcgaccgg
gtggtcatgcccttcaacatcgcctgcggcttctgcttcaactgtgtgcggggctatacc
ggcttctgcctgacggcgaaccccggcttcgccggcagcgcctacggctacgtcgccatg
ggcccctacccgggcgggcaggccgagttgctgcgcgttcccttcgccgacttcaactgc
ctcaagctcccaggtcaaccgggcgatcagtgggaagatgactttatgatgctggccgac
atcttccccaccggctaccacgggacagagctggcagacgttcgtcccggcagcaccgtc
gccgtcttcggggccggcccggtggggctgatggcggcctacagcgccctcctccgcggc
gcttcggaggtctacgtcgttgaccgcgtgccggagcgcctgcagaaagcgaaggagatc
ggcgcgatcccaatcgacttctccaagggcgacccggtggagcagatcttcgacatgcgc
cggcagaacgcaggcgtcaccggcgccatgcgccccggtgaagagagcatgatcggcgtc
atgtgcggtatcgacgcggtcggctaccaggcgttctctcacgggaccggaagccaggag
cagccgaaccaggtgctcgaagacctgatccgggtggtgaacccaaccgggcggatcggt
atcccagggctctacgtgccgaccgatccgggcggcgtcgaccaggccgccaagcagggg
cagttgctcctctccttcgggaaaatgttcgagaaggggatccggctcggtaccggccag
accaacgtgaagcagtacaacgtcttcctgcgcgacctgatcatctccggccgcgccaag
ccgagcttcgtcgtcagccaccgggtgccgctcgagaaggcgccggaggcctacgagaag
ttcgacaagcgggtcgagggctacacgaaggtagtgctcaagccgcagcagaccgctgcc
gactag

DBGET integrated database retrieval system