KEGG   Sphaerobacter thermophilus: Sthe_3425Help
Entry
Sthe_3425         CDS       T01128                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00625  Chloroalkane and chloroalkene degradation
sti00680  Methane metabolism
sti01100  Metabolic pathways
sti01120  Microbial metabolism in diverse environments
sti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Sthe_3425
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sthe_3425
Enzymes [BR:sti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Sthe_3425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like Pyr_redox_2 TrkA_N FAD_binding_3 3HCDH_N Pyr_redox DAO
Motif
Other DBs
NCBI-ProteinID: ACZ40824
JGI: Sthe_3425
UniProt: D1CAI1
Position
2:complement(1133964..1135169)
Genome map
AA seq 401 aa AA seqDB search
MKAVVYKGPNQVAVEEVPDPKIEAPTDVLVRITSSAICGSDLHMYEGRTAASPGIVFGHE
NMGVVEEVGSGVASIKKGDRVVMPFNIACGFCFNCVRGYTGFCLTANPGFAGSAYGYVAM
GPYPGGQAELLRVPFADFNCLKLPGQPGDQWEDDFMMLADIFPTGYHGTELADVRPGSTV
AVFGAGPVGLMAAYSALLRGASEVYVVDRVPERLQKAKEIGAIPIDFSKGDPVEQIFDMR
RQNAGVTGAMRPGEESMIGVMCGIDAVGYQAFSHGTGSQEQPNQVLEDLIRVVNPTGRIG
IPGLYVPTDPGGVDQAAKQGQLLLSFGKMFEKGIRLGTGQTNVKQYNVFLRDLIISGRAK
PSFVVSHRVPLEKAPEAYEKFDKRVEGYTKVVLKPQQTAAD
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgttgtctacaagggcccgaatcaggtcgccgtcgaggaagtccccgacccc
aagatcgaagcccccaccgatgtactcgtccgcatcacgtccagcgccatctgcggcagc
gatctccatatgtatgaggggcgcaccgccgcctcaccgggcatcgtcttcggccacgag
aacatgggcgtcgtggaggaggtcggcagcggcgtcgcgtcgatcaagaagggcgaccgg
gtggtcatgcccttcaacatcgcctgcggcttctgcttcaactgtgtgcggggctatacc
ggcttctgcctgacggcgaaccccggcttcgccggcagcgcctacggctacgtcgccatg
ggcccctacccgggcgggcaggccgagttgctgcgcgttcccttcgccgacttcaactgc
ctcaagctcccaggtcaaccgggcgatcagtgggaagatgactttatgatgctggccgac
atcttccccaccggctaccacgggacagagctggcagacgttcgtcccggcagcaccgtc
gccgtcttcggggccggcccggtggggctgatggcggcctacagcgccctcctccgcggc
gcttcggaggtctacgtcgttgaccgcgtgccggagcgcctgcagaaagcgaaggagatc
ggcgcgatcccaatcgacttctccaagggcgacccggtggagcagatcttcgacatgcgc
cggcagaacgcaggcgtcaccggcgccatgcgccccggtgaagagagcatgatcggcgtc
atgtgcggtatcgacgcggtcggctaccaggcgttctctcacgggaccggaagccaggag
cagccgaaccaggtgctcgaagacctgatccgggtggtgaacccaaccgggcggatcggt
atcccagggctctacgtgccgaccgatccgggcggcgtcgaccaggccgccaagcagggg
cagttgctcctctccttcgggaaaatgttcgagaaggggatccggctcggtaccggccag
accaacgtgaagcagtacaacgtcttcctgcgcgacctgatcatctccggccgcgccaag
ccgagcttcgtcgtcagccaccgggtgccgctcgagaaggcgccggaggcctacgagaag
ttcgacaagcgggtcgagggctacacgaaggtagtgctcaagccgcagcagaccgctgcc
gactag

DBGET integrated database retrieval system