KEGG   Sphaerobacter thermophilus: Sthe_3485Help
Entry
Sthe_3485         CDS       T01128                                 

Definition
(GenBank) Mg-chelatase subunit ChlI-like protein
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sti  Sphaerobacter thermophilus
Pathway
sti00860  Porphyrin and chlorophyll metabolism
sti01100  Metabolic pathways
sti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sthe_3485
Enzymes [BR:sti01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Sthe_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Sigma54_activat Mg_chelatase AAA_3 NCA2
Motif
Other DBs
NCBI-ProteinID: ACZ40884
JGI: Sthe_3485
UniProt: D1CAP1
Position
2:1203967..1205364
Genome map
AA seq 465 aa AA seqDB search
MTKPRTLGELRESGYQVLSVREEMRKNLIQKLRTGEPIFPGVIGYDHTVIPQVENAILSG
QDIIFLGERGQAKTRMARSLVNLLDEEVPAVAGSEIHDNPFAPISRYARDLIAEKGDYTP
IVWIRREERYAEKLATPDTTIADLIGEVDPIKVAEGRYLSDELTIHYGLIPRTNRGIFAI
NELPDLAERIQVGLLNILEERDVQIRGYRIRLPLDVYIVASANPEDYTNRGRIITPLKDR
YGSQIRTHYPETIDLEIEIMEQERRQFDTDGIEVMVPDFMREVVAEITHLARRSHDVSQR
SGVSVRMSISNYENVISNAIKRAIRLGEKQAVPRISDLHAAVASTTGKIELEALGEVQED
RIVDKLMQGAVLTTFNRYFSVRDFDDLVLAFENGLTVETSDMMPAMNYVHQVSHIDGFRE
AAGRLGAAGNPSAIASAVEFVLEGLHLNRRLNKDTGGRTGVRYRG
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgactaagccgcggaccctcggcgaacttcgggagagcggctatcaggtgctctcggtc
cgggaggagatgcgtaagaacctgatccagaagctccgcaccggggagccgatcttccct
ggtgtgatcgggtacgatcacaccgtgatcccgcaggttgagaacgccatcctctccggg
caggacatcatcttcctcggcgagcgcgggcaggccaagacccggatggcccgcagcctc
gtcaacctcctcgacgaggaggtcccggcagtggccggcagcgagatccacgacaacccg
tttgcgccgattagccgctacgcccgcgacctgatcgccgagaagggggactacaccccg
atcgtctggattcgccgggaggaacgctacgcggagaagctggcgacgccggacaccacc
attgccgacctgatcggcgaggtggacccgatcaaggtggccgaggggcggtacctctcc
gacgagttgaccatccactacgggcttatcccgcggacaaaccggggcatcttcgccatc
aacgagttgccagatctggccgagcgcatccaggtaggcctgctgaacatccttgaggag
cgggatgtccagatccgcggctaccggatccgcctgccgctcgacgtctacatcgtggcg
agcgccaacccggaggactacaccaaccgcgggcgcatcatcacgccgctcaaggaccgc
tacggctcgcagatccggacgcactacccggagacgatcgatcttgagatcgagatcatg
gagcaggagcggcggcagttcgacaccgacggcatcgaggtgatggtgcccgacttcatg
cgcgaggttgtggccgagatcacgcacctggcccggcgcagccacgatgtgagccagcgc
tccggcgtcagcgtgcgtatgtcgatctccaactatgaaaacgtcatcagcaacgccatc
aagcgagcgatccgcctgggtgagaagcaggcagtgccgcgcatcagcgacctgcacgcc
gcggtcgcctcgacgaccggcaagatcgagctcgaggcgctcggcgaggtccaggaggac
cgcatcgtcgacaagctgatgcagggagcggtgctgaccacgttcaaccgctacttctcc
gtgcgcgacttcgacgacctggtacttgccttcgagaacggcctgaccgtggagacctcg
gacatgatgccggcgatgaactacgtgcaccaggtctcgcacatcgacgggttccgcgag
gcggcgggccggctcggcgccgcgggcaaccccagcgccatcgcgtccgccgtcgagttc
gtgctcgaagggctgcatctcaaccgccggctgaacaaggacacgggtggacgcacgggt
gtgcgctaccggggatag

DBGET integrated database retrieval system