KEGG   Streptococcus salivarius JIM8777: SALIVA_0843Help
Entry
SALIVA_0843       CDS       T02089                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:stj01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:stj00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
840130..841413
Genome map
AA seq 427 aa AA seqDB search
MKRLTGTNKEIAELLYQEQLELSKENRDVESTVQAIIEDVKKRGDEALRDYSAKFDKVDL
TDFEVGQDLIDQAFKEIDPEVYQALVSAKENIESYHKHQLEAGFEDQPSEGVIRGQLIRP
INRVGVYVPGGTAAYPSSVLMNVIPAKIAGVKEIIMITPPQEHFVPAILVAAKLAGVDSI
YQVGGAQGVAALAFGTETIPKVDKITGPGNIFVATAKKQVYGIVGIDMIAGPSEIGVIAD
SSANPTYVAADLLSQAEHDTRARAILVTDSEALADAVESEIERQLKLLPREAIARPSVEN
NGRIIIANDTDGMFELMNLVAPEHLEIAMDNAYDYLEKVENAGSVFLGHFTSEPIGDYYA
GANHVLPTTATSRFSSALGVHDFVKRIQYTQYDKAAVNKAQHDITTLAYAEGLQAHAKAI
EVRNDNN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattaactggaacaaataaagaaattgctgagcttctttatcaggagcaattg
gaactttcaaaagaaaatagagacgttgaaagcacggttcaagccattattgaggatgtc
aaaaaacgaggagacgaggcccttcgtgactattcagctaaatttgataaggttgacttg
actgattttgaggttggacaggatttgattgatcaagcctttaaagagattgatccagag
gtttaccaagccctagttagtgccaaagaaaacattgaatcttaccacaagcatcagttg
gaggctggttttgaggaccaaccaagtgagggtgttattcgtggtcaattgattcgtccc
atcaatcgtgtgggtgtttatgtgcctggaggaacagcggcttatccatcatcagttctt
atgaatgtcattcctgctaaaattgctggggttaaagagattattatgattacgccgcca
caagaacactttgttcctgcaattctggtagctgcaaaattggctggtgtggatagcatt
taccaagtcggtggggctcaaggggttgcggctttggcctttggtacagaaacgattcca
aaggtggacaagattacaggtcctggtaatattttcgtggcgactgcaaagaagcaagtt
tacggtattgtcggtattgatatgattgcagggccatcagaaattggtgtcattgctgat
agtagtgccaatccaacctatgtggcagctgacctcttgtctcaagcagagcacgataca
cgcgcacgcgccattttggtcacagattctgaagccttggctgatgcggttgaaagtgag
attgaacgtcaactcaagcttttgccacgtgaggcgattgctcgtccatctgtcgaaaat
aacggccgtattattattgccaatgatacagatggcatgttcgagctcatgaacttggtt
gcgccagaacatttggaaattgctatggacaatgcctatgattacttggaaaaagtggaa
aatgctggttccgtctttcttggtcactttaccagcgaaccaattggcgactactatgca
ggtgccaaccatgttcttccaacgacagcaaccagccgcttttcatcagctttaggcgtg
cacgattttgtcaaacgtatccaatatacgcaatacgataaggccgcagtcaataaggct
cagcacgatatcacaaccttggcttacgcagaaggtttgcaggcccacgccaaggcaatt
gaagtcagaaacgacaataactga

DBGET integrated database retrieval system