KEGG   Streptococcus salivarius JIM8777: SALIVA_1084Help
Entry
SALIVA_1084       CDS       T02089                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (Amylomaltase) (Disproportionating enzyme) (D-enzyme) (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:stj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SALIVA_1084 (malQ)
Enzymes [BR:stj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SALIVA_1084 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105274..1106773
Genome map
AA seq 499 aa AA seqDB search
MNKRASGVLMHITSLPGDYGIGSFGQAAYDFVDFLKETKQTYWQILPLTTTSYGDSPYQS
FSAVAGNTHFIDLDFLIRDKFLTKADVKDADFGSDSEFIDYAKVYEARRPILEKAVKAIL
ADKKEAKKFEAFKTKNANWLADYAEFMAIKEHFDNKALQEWDDKKAVKRDKATLEKLRKE
LAEVITYHEVVQYLFFSQWAELKAYANENGIQIIGDMPIYISADSVEVWTQPHLFKLDAE
CKPRYIAGVPPDNFSATGQLWGNPIYAWDKHKAENYAWWVFRIQESFKLYDYLRIDHFKG
FSDFWEIPGGDETAENGEWVPGPGYDLFKVVKEELGDLKIIAEDLGNIDDKTRKLLSDCG
YPGMKIVQFGFYDTTGNSIDIPHVYTQHSVAYTGTHDNEVINGWYDNLTQEQRDYTDAYI
NRRQGEPITRALLRTLFATVSNTAIATMQDILDKPENSRTNFPNTVGENWKWRMLPGEIT
VDKKEFLTDITERYNRGNN
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacgagcaagcggtgtattgatgcacatcacatcacttccaggtgactacggg
atcggatctttcggtcaagcagcctatgactttgttgatttcttgaaagaaacaaaacaa
acatactggcagatcttgccacttactacaacaagttatggggactcaccttatcaatca
ttctctgcggtagcggggaacacacacttcatcgatttggatttccttattcgtgacaag
tttctaactaaagctgatgttaaagacgctgactttggatcagattcagagtttatcgac
tatgctaaagtttatgaagcacgtcgtccaatccttgaaaaagcagtaaaagctatcttg
gcagataaaaaagaagctaaaaaattcgaagcttttaaaactaaaaatgctaactggtta
gctgattatgctgaattcatggctatcaaagaacactttgataataaagcccttcaagaa
tgggatgataaaaaggcggttaaacgtgataaagcaacacttgaaaaacttcgtaaggaa
cttgctgaagtgattacttatcacgaagtggttcaatacctattctttagtcaatgggct
gaacttaaagcttatgccaatgagaatggtattcaaattatcggtgacatgccaatttac
atctcagctgatagtgttgaagtttggacgcaaccacatctcttcaaactagatgcagag
tgtaaaccacgttacattgccggagttccaccagataacttctcagctactggtcaactt
tggggtaacccaatctacgcttgggataaacacaaagctgaaaattatgcttggtgggta
ttccgtattcaagaatcattcaaactttatgattacttgcgtatcgaccacttcaaaggc
ttctctgatttctgggaaatccctggcggagatgaaactgctgaaaatggtgaatgggtt
cctggacctggttatgacctcttcaaagtggtcaaagaagaattgggtgatcttaaaatc
attgccgaagaccttggtaacattgatgataagacacgtaaacttctttcagactgtggt
taccctggaatgaagattgttcaatttggtttctacgatactactggaaacagcattgat
attccacatgtatacacacaacattcagttgcttacacaggtacacatgataacgaagta
atcaacggttggtacgacaacttgacgcaagagcaacgtgattacactgatgcttacatt
aaccgtcgtcaaggtgaaccaattacacgtgctctccttcgcacactctttgctacagta
agcaacacagctattgcgactatgcaggatatccttgataaacctgaaaatagccgtaca
aacttccctaacacagttggtgaaaactggaaatggcgtatgcttccaggtgaaatcact
gtagacaagaaagaatttttgacagacattacagaaagatataatcgaggtaataactaa

DBGET integrated database retrieval system