KEGG   Streptococcus salivarius JIM8777: SALIVA_1488Help
Entry
SALIVA_1488       CDS       T02089                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching enzyme (Glycogen-branching enzyme) (BE) (1,4-alpha-D-glucan:1,4-alpha-D-glucan 6-glucosyl-transferase) (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:stj00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SALIVA_1488 (glgB)
Enzymes [BR:stj01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SALIVA_1488 (glgB)
Exosome [BR:stj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SALIVA_1488 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1634902..1636782)
Genome map
AA seq 626 aa AA seqDB search
MNLDEAMYTFGTGENFHLQNYLGVHELEGEEGFIFRVWAPHAEQIQVIGDFTGWFDEPLD
MTKNHIGVWEATSALPEEGQLYKFLVKRKGGQVVEKMDPFATYLEPRPGTGAVIRKKKTK
KWKDGLWMGRRKRFGFQKRPVNIYEAHASSWKLKEDGQPYTFKELKEELIPYLVEMNYTH
VEFMPLMAHPLGMSWGYQLMGYFAFEHTYGTPEEFQDFVEACHQNNIGVLVDWVPGHYTQ
NDDALAYFDGTPTFEYQDHDRAHNYRWGALNFDLGKNQVQSFLISSALYWIENYHIDGIR
VDAVSNMLYLDYDEGPWMPNKDGGNRNLEGYGFLQKLNREIKKRYPDVMMVAEESTAATP
ITQPIEEGGLGFDFKWNMGWMNDILKFYAEDPVYRQYDFNLMTFSFMYCFNENYVLPFSH
DEVVHGKKSMMHKMWGDRYNQFAGLRNLYAYQLCHPGKKLLFMGSEFGQFLEWKFDYQLE
WGNLEDEMNQKMQAFTSHMNAFYKDHKSLWQIDDSYDGIEIIDADNRAESVLSFIRKDDK
GDKGDFLVCVFNLAPVERQNFTIGLPVAGIYQEVLNTEMEEFGGVWKEGNPETRTQKAKW
KDYENTLSFTLPALGASIWRVKRRLK
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgaatctcgatgaagccatgtacacatttggaacaggtgagaacttccaccttcagaat
tatttgggtgtgcatgaattagagggagaagaaggttttatcttccgtgtgtgggcccct
catgctgagcagattcaggtaattggagatttcacaggttggtttgatgaacctctggat
atgaccaaaaaccatatcggtgtttgggaggcgacttcagctctcccagaggaaggacaa
ctctataagttcttggtgaaacgtaagggaggtcaagtcgtcgaaaagatggatcctttt
gcgacttacttagagcctcgtcctggaacaggagctgtgattcgtaagaagaaaactaag
aagtggaaggatggcctttggatgggtcgtcgtaaacgctttggtttccaaaaacgtccg
gttaatatctatgaagctcatgcatcatcttggaaactaaaagaggatggtcaaccttat
actttcaaagaattgaaagaagagttgattccatatttggttgagatgaactatactcac
gtggaattcatgccactcatggctcatcctcttgggatgagttggggttaccagcttatg
ggttactttgcttttgagcatacctatggcacaccagaagaatttcaagatttcgtagaa
gcatgtcaccagaataatatcggtgtcttggtagactgggtcccaggtcactatacacag
aatgacgatgctttggcctacttcgatggtacaccaactttcgaatatcaggatcatgat
cgagctcataactatcgttggggcgcacttaactttgacttaggaaaaaatcaagttcag
tctttccttatttcaagtgctctttactggattgaaaattatcatatcgatggtatccga
gtggatgcagtatctaacatgctctatttggactatgatgaaggtccatggatgcctaac
aaggacggtggaaatcgtaacttggaaggctacggcttccttcaaaaactcaatcgtgaa
attaaaaaacgctatccagatgttatgatggttgcggaagaatcaactgcagcaacgcca
atcacccaaccgattgaagaaggtggtctaggtttcgacttcaaatggaatatgggttgg
atgaacgatatcctcaaattctacgcagaagatccagtttaccgtcagtatgacttcaat
ctgatgaccttcagtttcatgtattgcttcaatgaaaactatgttctacctttctcacat
gatgaagtggttcatggtaagaagagcatgatgcataagatgtggggtgaccgctataat
caatttgctggtcttcgtaacctctatgcttaccaactctgtcacccaggtaagaaattg
ctctttatgggttctgagtttggtcaattcttggagtggaagtttgattatcaactcgaa
tggggtaatcttgaagatgagatgaaccagaagatgcaggcctttactagccatatgaat
gctttctacaaggaccataaatctctctggcagattgatgattcttacgatggtattgag
attatcgatgcggataaccgtgctgaaagtgttctttccttcattcgtaaagatgataaa
ggcgataagggtgacttcctcgtctgtgtcttcaacctagctccagtggaacgtcaaaac
ttcactattggattgccagtagctggtatctaccaagaagtgcttaacactgagatggaa
gaattcggtggcgtttggaaagaaggaaatcctgaaacccgtacccaaaaagcgaagtgg
aaggactatgaaaatacccttagcttcaccctacctgctctaggagcaagtatctggcgt
gtaaaacgtcgtttgaaataa

DBGET integrated database retrieval system