KEGG   Streptococcus salivarius JIM8777: SALIVA_1705Help
Entry
SALIVA_1705       CDS       T02089                                 

Gene name
aspC2
Definition
(GenBank) uncharacterized aminotransferase yfbQ
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
stj  Streptococcus salivarius JIM8777
Pathway
stj00220  Arginine biosynthesis
stj00250  Alanine, aspartate and glutamate metabolism
stj00290  Valine, leucine and isoleucine biosynthesis
stj01100  Metabolic pathways
stj01110  Biosynthesis of secondary metabolites
stj01130  Biosynthesis of antibiotics
stj01210  2-Oxocarboxylic acid metabolism
stj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:stj00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SALIVA_1705 (aspC2)
   00290 Valine, leucine and isoleucine biosynthesis
    SALIVA_1705 (aspC2)
   00220 Arginine biosynthesis
    SALIVA_1705 (aspC2)
Enzymes [BR:stj01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SALIVA_1705 (aspC2)
    2.6.1.66  valine---pyruvate transaminase
     SALIVA_1705 (aspC2)
Amino acid related enzymes [BR:stj01007]
 Aminotransferase (transaminase)
  Class I
   SALIVA_1705 (aspC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CCB96009
Position
complement(1849249..1850463)
Genome map
AA seq 404 aa AA seqDB search
MKTFDKSSKLEHVAYDIRGPVLDEANRMIANGEKILRLNTGNPAEFGFTAPDEVIRDLIM
NVRNSEGYSDSKGIFSARKAIMQYCQLKGFPNVDIDDIYIGNGVSEMISISMQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYVCDEKSNWYPDIDDIKSKITSNTKAIVVINPNNP
TGSLYPKDVLEQIVDIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKKNVKGYIEGLNMLANMRLCANVLSQHVIQTSLGGYQSVDELL
IPGGRIYEQREFITNTVNAIPGLSAVKPDAGLYIFPRIDRNMYDIEDDEEFCLRLLKKEK
VLLVPGKGFNWNEPDHFRIVYLPRVEELADLGNKIERVLSYYKR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatttgataaatcatcaaagttggaacacgttgcctatgatattcgtggacca
gttttggatgaagccaaccgtatgattgctaacggtgaaaagattcttcgtcttaatacg
ggaaatcctgcggaatttggctttacagcaccggatgaagtcattcgtgatttaattatg
aatgttcgtaacagtgaagggtattcggatagtaaagggattttctcagctcgtaaggcg
attatgcagtattgccagctaaagggattcccaaatgtagatattgatgatatttatatt
ggtaatggtgtttcagagatgatttccatatctatgcaggccttgcttgatgatggagat
gaagtcttggtcccaatgccagattatcctctttggacagcctgtgtcagtctagcaggc
ggtaatgccgtacactatgtctgtgatgaaaaatctaactggtatccagatattgatgat
atcaaatcaaagattacatcaaatactaaggcaattgtagtcatcaatcccaataatcct
acaggttcgctctatcctaaggatgttcttgaacagattgtggatattgctcgacaaaat
gatttgattatctttgcggatgagatttatgaccgcttggttatggatggtaagaaacat
actgcaatcgctagtcttgcaccagatgtcttctgcgtgtctatgaatggtctttctaag
tctcaccgcatctgtggtttccgtgtgggttggatggttctttctggacctaaaaagaat
gtcaaaggctatattgaagggcttaatatgttggctaacatgcgtctctgtgccaacgtg
ctctctcaacacgttattcagacttcacttggtggctaccaatccgttgatgagctcttg
attcctggtgggcgtatctatgaacaacgtgagtttatcacgaataccgtaaacgctatt
ccagggctatcagctgttaagccagatgcagggctttacatcttccctaggattgaccgt
aacatgtatgatattgaagatgatgaagaattctgtcttcgtctcttgaagaaggagaag
gttctcctagttccaggtaaaggctttaactggaatgaaccagatcacttccgtattgtc
tatcttcctcgagtggaagagttggctgatctcggtaataaaatcgaacgagtcttgtca
tattacaagcgctaa

DBGET integrated database retrieval system