KEGG   Streptococcus parauberis: STP_0041Help
Entry
STP_0041          CDS       T01504                                 

Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Benzoate degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:stk01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:stk00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:stk00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:stk00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:stk00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:stk00350]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:stk00362]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:stk00625]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:stk00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54253..55185
Genome map
AA seq 310 aa AA seqDB search
MVEQKMTPEQKLADAQAHVDELVQKGLGALEEFRKLNQEQVDYIVAKASVAALDAHGILA
MHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIEEDDVTGLTMIAEPVGVICGV
TPTTNPTSTAIFKSLIALKTRNPIVFGFHPSAQESSAHAAQIVRDAAIAAGAPENCIQWI
SKPSMEATGALMNHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKTANIRQA
AHDIVMSKSFDNGMVCASEQAVIIDKEVYDQFVEEFKSYRTYFVNKKKKLFLKNSVLVQK
QTAKTVLVQN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacaaaaaatgacaccggaacaaaaattagcagatgcacaagcacacgttgat
gagcttgtccaaaaaggtctcggtgccttagaagaattccgtaaattaaatcaagagcaa
gtagactatattgttgctaaagcttcagttgctgctttagatgctcacggtatcttagca
atgcatgcttttgaagaaactggtcgtggtgtttttgaagataaagcgactaaaaactta
tttgcttgtgaacacgttgttaacaacatgcgtcatacaaaaacagttggaattattgaa
gaagatgatgttacaggtttgactatgattgctgaaccagttggtgttatctgtggtgtt
acaccaacaacaaacccaacttcaacagctatctttaaatctttgattgctttgaaaaca
cgtaatccaattgtctttggtttccacccatcagctcaagaatcttcagcacacgcagca
caaatcgttcgtgacgctgcgattgctgcaggagctcctgagaattgtatccaatggatt
tcaaaaccttctatggaagctactggcgctttgatgaatcacgatggtattgcaactatt
cttgcaactggtggtaatgcaatggttcgtgcagcatattcatgtggtaaacctgccctt
ggtgtaggagctggtaatgtacctgcttatgttgaaaaaacagcaaatatccgtcaagca
gcacatgacattgttatgtctaaatcatttgataatggtatggtttgtgcttctgaacaa
gcagttattatcgataaagaagtttatgatcaatttgttgaagaatttaaatcatacaga
acttactttgtaaacaaaaagaaaaagctcttcttgaagaattctgttttggtgcaaaag
caaacagcaaaaactgtgctggtgcaaaattaa

DBGET integrated database retrieval system