KEGG   Streptococcus parauberis: STP_0041Help
Entry
STP_0041          CDS       T01504                                 

Definition
aldehyde-alcohol dehydrogenase 2
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
stk  Streptococcus parauberis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:stk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    STP_0041
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    STP_0041
   00620 Pyruvate metabolism
    STP_0041
   00650 Butanoate metabolism
    STP_0041
  Lipid metabolism
   00071 Fatty acid degradation
    STP_0041
  Amino acid metabolism
   00350 Tyrosine metabolism
    STP_0041
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    STP_0041
   00626 Naphthalene degradation
    STP_0041
Enzymes [BR:stk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     STP_0041
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     STP_0041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
54253..55185
Genome map
AA seq 310 aa AA seqDB search
MVEQKMTPEQKLADAQAHVDELVQKGLGALEEFRKLNQEQVDYIVAKASVAALDAHGILA
MHAFEETGRGVFEDKATKNLFACEHVVNNMRHTKTVGIIEEDDVTGLTMIAEPVGVICGV
TPTTNPTSTAIFKSLIALKTRNPIVFGFHPSAQESSAHAAQIVRDAAIAAGAPENCIQWI
SKPSMEATGALMNHDGIATILATGGNAMVRAAYSCGKPALGVGAGNVPAYVEKTANIRQA
AHDIVMSKSFDNGMVCASEQAVIIDKEVYDQFVEEFKSYRTYFVNKKKKLFLKNSVLVQK
QTAKTVLVQN
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggttgaacaaaaaatgacaccggaacaaaaattagcagatgcacaagcacacgttgat
gagcttgtccaaaaaggtctcggtgccttagaagaattccgtaaattaaatcaagagcaa
gtagactatattgttgctaaagcttcagttgctgctttagatgctcacggtatcttagca
atgcatgcttttgaagaaactggtcgtggtgtttttgaagataaagcgactaaaaactta
tttgcttgtgaacacgttgttaacaacatgcgtcatacaaaaacagttggaattattgaa
gaagatgatgttacaggtttgactatgattgctgaaccagttggtgttatctgtggtgtt
acaccaacaacaaacccaacttcaacagctatctttaaatctttgattgctttgaaaaca
cgtaatccaattgtctttggtttccacccatcagctcaagaatcttcagcacacgcagca
caaatcgttcgtgacgctgcgattgctgcaggagctcctgagaattgtatccaatggatt
tcaaaaccttctatggaagctactggcgctttgatgaatcacgatggtattgcaactatt
cttgcaactggtggtaatgcaatggttcgtgcagcatattcatgtggtaaacctgccctt
ggtgtaggagctggtaatgtacctgcttatgttgaaaaaacagcaaatatccgtcaagca
gcacatgacattgttatgtctaaatcatttgataatggtatggtttgtgcttctgaacaa
gcagttattatcgataaagaagtttatgatcaatttgttgaagaatttaaatcatacaga
acttactttgtaaacaaaaagaaaaagctcttcttgaagaattctgttttggtgcaaaag
caaacagcaaaaactgtgctggtgcaaaattaa

DBGET integrated database retrieval system